Organic Halides

<p>Please enquire for more information about H-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of idelalisib (CAL 101)</p>

<p>ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.</p>

<p>4-Iodobiphenyl is a boronic acid that can be used in the Suzuki coupling reaction. It is an analog of biphenyl and diphenyl ether, with spacing that allows for aryl boronic acids to bind to it. 4-Iodobiphenyl has been shown to inhibit protein synthesis in the cytosol of erythrocytes and leukocytes. This compound can also be used as a bioactive molecule due to its ability to bind with proteins and lipids. 4-Iodobiphenyl has been shown to have anti-inflammatory activities due to its ability to inhibit prostaglandin synthesis by binding with arachidonic acid.</p>

<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>

<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br&gt;<br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>

<p>3-Fluoroamphetamine hydrochloride (3FAH) is a histological and microscopic technique used to study the effects of analgesics on human skin. 3FAH is an analgesic that has been shown to reduce pain in a number of studies. It has also been observed to enhance the effects of laser treatments on human skin, as it reduces inflammation and increases transdermal permeation. This drug is applied topically or injected for the treatment of pain, muscle spasms, or Parkinson’s disease. 3FAH can be administered by iontophoresis or permeation techniques, which are both effective ways to deliver drugs through skin.</p>

<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>

<p>Z-Val-Lys-Lys-Arg-4MbNA is a synthetic peptide that is used for staining of fixed cells. It binds to lysosomal membrane proteins and stains with a red color when reacted with a chromogen. This product is used as an intermediate in the production of monoclonal antibodies. Z-Val-Lys-Lys-Arg-4MbNA is also used to detect lysosomes in unfixed cells by histochemically staining the reaction product with a solution of buffers and biochemical, following incubation at 37°C for 24 hours. This product has been shown to bind to cellular morphology, fibroblasts, and stained tissue sections.</p>

<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rhodium(III) chloride hydrate is a catalyst that is used in the oxidation of aromatic hydrocarbons. It has been shown to have an acidic reaction with hydrochloric acid and is used in the oxidation of benzene, toluene, ethylbenzene, and xylene. Rhodium(III) chloride hydrate has also been shown to be a good catalyst for the production of polycyclic aromatic hydrocarbons from light emitting diodes. This product can be used as an oxidizing agent in organic synthesis reactions. The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of</p>

<p>3-(3,4-Dichlorophenyl)propanoic acid is a potent inhibitor of the lysine methyltransferase enzyme. This enzyme catalyzes the transfer of methyl groups from S-adenosylmethionine to lysine residues in proteins, and it is involved in cancer cell proliferation. 3-(3,4-Dichlorophenyl)propanoic acid inhibits the activity of this enzyme by covalently binding to lysine residues on the protein and preventing their methylation. Research has shown that 3-(3,4-Dichlorophenyl)propanoic acid can block tumor growth by inhibiting the activity of this enzyme.</p>

<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>4-Bromo-3-nitrobenzoicacid is a fluorogenic substrate for the labeling of d-serine. It reacts with picric acid to form a fluorescent product, which can be detected by fluorescence spectroscopy. 4BnBA has been used in immobilized enzyme studies to determine the catalysis of chloride and the fluorescence response of chloride. The hydrolysis of 4BnBA by esterases produces 3-nitroaniline, which has been shown to be an intermediate for the synthesis of flavin mononucleotide (FMN). FMN is an essential cofactor for catalytic reactions involving ribonucleotides and ATP. The subunits of FMN are flavin adenine dinucleotide (FAD) and nicotinamide adenine dinucleotide (NAD). 4BnBA has also been analysed using synthetic techniques and functional theory to determine its role in biomolecular processes.</p>

<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chloro-4-hydroxybenzyl alcohol is an organic compound that has been shown to be soluble in aqueous alkali metal solutions, but insoluble in water. It is also insoluble in polymer solvents such as acetone and ethyl ether. 2-Chloro-4-hydroxybenzyl alcohol is a sugar alcohol with 3 hydroxyl groups. The molecule has a molecular weight of 150.17 g/mol, melting point of -123°C (-198°F), boiling point of 179°C (354°F), and refractive index of 1.5774 at 20°C (68°F). This chemical can be used in the synthesis of polyhydric alcohols such as glycerol or hexanol. 2-Chloro-4-hydroxybenzyl alcohol is not soluble in hydrochloric acid, benzene or chloroform, and does not react to form any es</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about BNP-45 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Lys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>

<p>5'-Bromo-2'-hydroxypropiophenone is a synthetic compound that inhibits the dimerization of survivin, which is a protein involved in cancer pathways. This compound has been shown to inhibit the growth of cells in culture and can be used as an inhibitor for assays. 5'-Bromo-2'-hydroxypropiophenone has also been shown to integrate into DNA, which may lead to chromosomal rearrangements and mutations. It also binds with high affinity to the family of modifications borealin, which are implicated in cellular processes such as cell differentiation and proliferation.</p>

<p>1-(3-Chloro-4-methoxyphenyl)acetone is a white solid with a melting point of 60-61°C. It is a versatile building block that can be used in the synthesis of complex compounds and as a reaction component for the preparation of speciality chemicals. 1-(3-Chloro-4-methoxyphenyl)acetone has been studied extensively as an intermediate for the synthesis of pharmaceuticals, including acetaminophen and amoxicillin. This compound also has uses in research laboratories and as a reagent in organic synthesis.</p>

<p>3-Trifluoromethyl phenylhydrazine HCl is a fine chemical that can be used as a versatile building block in the synthesis of complex compounds. It has been shown to be a useful intermediate for the preparation of research chemicals, reaction components and speciality chemicals. 3-Trifluoromethyl phenylhydrazine HCl belongs to CAS No. 3107-33-3 and can be used as a reagent in organic synthesis. The compound is high quality with a purity of over 99%.</p>

<p>2,6-Dichloro-5-fluoronicotinic acid (2,6-DCFNA) is a chlorinating agent that is activated in acidic solutions. It is used to produce the disinfectant peracetic acid and in the industrial process of producing phenol. 2,6-DCFNA reacts with chloride to form hypochlorous acid (HOCl), which causes inflammation in cells by activating inflammatory cells such as neutrophils and macrophages. 2,6-DCFNA also inhibits tyrosine kinase activity, which may contribute to its anti-inflammatory properties. The toxic effects of 2,6-DCFNA have been studied on hematopoietic cells in vitro. Studies show that this compound can cause apoptosis or death of these cells and may be useful for the treatment of inflammatory diseases such as rheumatoid arthritis. 2,6-DCFNA has also been shown to inhibit tumor growth when</p>

<p>Cinnamoyl chloride is an organic compound that can be synthesized in an asymmetric fashion. It is a metabolite of cinnamoyl-CoA and has been shown to have photochemical properties. Cinnamoyl chloride has also been shown to inhibit the growth of cervical cancer cells. This compound also has hydroxyl groups, which may act as an amide or receptor activator. Cinnamoyl chloride may be used for the treatment of infectious diseases such as chlamydia and mycoplasma.</p>

<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans</p>

<p>Please enquire for more information about Alloferon 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>

<p>Trifluoroacetate salt</p>

<p>Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.</p>

<p>Intermediate in the synthesis of tofacitinib</p>

<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5'-(6-Fluorescein) phosphoramidite is an oligonucleotide that can be used to label other molecules. It is a synthetic, cellular moiety that functions as a glycoconjugate and binds to the receptor-mediated endocytosis pathway. It is taken up by cells via a mechanism involving hyaluronic acid, which is also involved in receptor-mediated endocytosis. 5'-(6-Fluorescein) phosphoramidite has been shown to have the ability to bind to disaccharides and form complexes with them. This property may be useful in studying the uptake of glycoconjugates into cells.</p>

<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Serpinin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-Bromothieno[2,3-b]pyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-6-chloro-1,3-benzenedisulfonamide is a natural substance that has been used in Chinese medicine preparations for the treatment of cardiac problems. It belongs to the class of organic compounds called benzenedisulfonamides. 4-Amino-6-chloro-1,3-benzenedisulfonamide is produced by the bacterial enzyme aminase from amino acid and benzoic acid. The adsorption mechanism of 4-Amino-6-chloro-1,3-benzenedisulfonamide is not fully understood, but it is believed that the benzyl groups are key players in this process. The high affinity of 4-Amino-6-chloro1,3 benzenedisulfonamide to proteins may be due to its ability to form hydrogen bonds with protein side chains, such as serine or threonine residues. 4 Amino</p>

<p>Please enquire for more information about Biotinyl-Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sodium 2,3,5,6-Tetrafluoro-4-hydroxybenzenesulfonate is a synthetic compound that is used as a probe for catalytic reactions. It has been shown to be active in the oxidation of glycols and ethylene glycols. This compound is also useful for the tethering of metal atoms or ions. Sodium 2,3,5,6-Tetrafluoro-4-hydroxybenzenesulfonate can be used in catalysis due to its ability to act as an electron donor.</p>

<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endothelin-1 (11-21) trifluoroacetate salt H-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp is a peptide that is derived from endothelin. It has been shown to have an inhibitory effect on insulin stimulated glucose uptake in Sprague Dawley rats. This peptide has also been shown to bind to the endothelin receptor and act as a nonselective agonist. Endothelin 1 (11–21) trifluoroacetate salt H-Cys Val Tyr Phe Cys His Leu Asp Ile Ile Trp, when incubated with cells, had a maximal response at micron concentrations.</p>

<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>4-Fluorobenzoic acid is a chemical compound with the molecular formula C6H4FO2 and is a member of the group of chemicals known as carboxylic acids. It has been shown to have high levels of antibacterial activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). 4-Fluorobenzoic acid can be used for wastewater treatment and also has the potential to be used in other applications such as an antimicrobial agent or an additive in food packaging. The mechanism of its antibacterial activity is not well understood but may be related to its ability to inhibit the enzyme diphenolase, which catalyzes the conversion of phenols into quinones.</p>

<p>2-Bromooxazole is a synthetic compound that inhibits the translation of mRNA in pancreatic cancer cells by binding to the interleukin-1 receptor. It also inhibits diacylglycerol synthesis, which causes a reduction in the production of amide and fatty acid. 2-Bromooxazole has been shown to have an immunosuppressive effect on lymphocytic leukemia cells and chronic lymphocytic leukemia cells. This drug is currently being studied for its potential use as an anticancer agent.</p>

<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Bromo-3-methoxypyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 2,3-diamino-5-bromobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sodium channel blocker</p>

<p>3-Chloro-N,N-dimethylpropan-1-amine (3CMP) is a chemical that belongs to the group of organic solvents. It is soluble in water and has a low toxicity for mammals. 3CMP has been shown to have antimicrobial properties against typhimurium and other bacteria. 3CMP binds to the hydroxyl group of biomembranes and interferes with bacterial replication by inhibiting RNA synthesis. The mechanism of this inhibition may be due to the chloride ions that are released from the membrane or may be due to an increase in cell size, which can lead to hypertrophy. 3CMP binds to the chloride ion on bacterial membranes, which inhibits the synthesis of RNA by blocking its ability to bind with the ribosome. This leads to cell death by inhibiting protein synthesis and cell division.</p>

<p>Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Fluoro-3-nitroaniline is a chemical that can be used for industrial preparation. It is an efficient method for the production of 4-fluoroaniline, which is used in the manufacture of dyes and pharmaceuticals. The chemical ionization technique has been shown to be a good way to determine the presence of 4-fluoro-3 nitroaniline in animals. It has also been found to be active against infections caused by bacteria such as Salmonella enterica, Escherichia coli, and Klebsiella pneumoniae. This chemical may have adverse effects on testicular function and hematocrit levels in animals.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuropeptide Y (18-36) trifluoroacetate salt H-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg -Gln is a peptide belonging to the family of neuropeptides. It has been shown to have potent vasoconstricting activity in rat and guinea pig hearts, as well as contractile activity in rat aortic rings. Neuropeptide Y (18 - 36) trifluoroacetate salt H -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifl uoroacetate salt also inhibits the cyclase activity of adenylate cyclase, which is responsible for generating the second messenger cAMP. This compound may be used to treat congest</p>

<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(±)-DoiHydrochloride is a serotonergic drug that belongs to the group of serotonin reuptake inhibitors. It affects the serotonergic system by inhibiting serotonin reuptake, which leads to increased synaptic concentrations of serotonin. This in turn activates signal pathways and increases levels of dopamine, norepinephrine, and epinephrine. (±)-DoiHydrochloride has antioxidative properties and can be used for the treatment of chronic schizophrenia. It was shown to be effective in patients with atrial fibrillation who were not responding well to other treatments.</p>

<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole is an organic compound that is used in the synthesis of carboxylic acid derivatives. It is a synthetic intermediate, which can be converted to other compounds by intramolecular hydrogen bonding. The efficiency of this method has been shown through a number of experiments. In nature, 1-methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole may be found as a hydrogen bond donor.</p>

<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>

<p>8-Quinolinesulfonyl chloride (8QSC) is a quinoline derivative that has been shown to have anticancer activity. 8QSC binds to the receptor site of cells and inhibits the production of amines, which are important for cell growth and proliferation. It also binds to hydrogen bonds, which may be involved in the cytotoxicity observed in pancreatic cancer cells. 8QSC shows significant cytotoxicity against Panc-1 cells, but not against NIH 3T3 cells. This may be due to its ability to form supramolecular aggregates with copper ions and quinoline derivatives.</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>

<p>4-Chloro-6-methoxyquinoline is an inhibitor of bacterial DNA gyrase. It has antibacterial activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Enterococcus faecalis, and Pseudomonas aeruginosa. 4-Chloro-6-methoxyquinoline is a synthetic compound that was reinvestigated for its antibacterial activity. It has been shown to be effective in the treatment of Staphylococcal infections. The mechanism of action may involve inhibition of topoisomerase II or interference with the synthesis of DNA by binding to the enzyme bacterial DNA gyrase. Quinidine and cinchonidine are quinine derivatives that have been found to inhibit bacterial DNA gyrase. These compounds are found in the bark of Cinchona species, which includes Cinchona ledgeriana, Cinchona officinalis, and Cinchona succirub</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Amino-6-fluorobenzoic acid ethyl ester is a chemical that can be used as a building block in the synthesis of more complex compounds. It is a versatile intermediate and can be used to synthesize other important compounds, such as pharmaceuticals. This compound has been shown to be useful for the preparation of 2-amino-4,6-difluorobenzoic acid ethyl ester and many other derivatives. The colorless solid is soluble in ether and dichloromethane.</p>

<p>Please enquire for more information about H-D-His(1-Me)-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>

<p>2-Bromo-6-methylpyridin-3-ol is a heterocyclic organic compound. It is a pyridine ring with two methyl groups attached to the ring at positions 2 and 6. The bromine atom is at position 3. This is an important intermediate in the Suzuki coupling reaction, which uses it as a starting material for the synthesis of many other compounds. The dieckmann condensation reaction produces this compound from 2,6-dichloropyridine and other reagents. Fluorescent when exposed to UV light, this compound has been used as a probe for chloride ions in solution using mass spectroscopy. This substance also yields dieckmann condensation products with alkynes and chlorine or bromine. 2-Bromo-6-methylpyridin-3-ol can be produced by treating pyridine with methylacrylate in the presence of catalysts such as copper(II)</p>

<p>Please enquire for more information about Acetyl-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>