
Organic Halides
In this category, you can find organic molecules containing one or more halogen atoms in their structure. These organic halides include brominated, iodinated, chlorinated, and cyclic halide compounds. Organic halides are widely used in organic synthesis, pharmaceuticals, agrochemicals, and materials science due to their reactivity and ability to undergo a variety of chemical transformations. At CymitQuimica, we offer a comprehensive selection of high-quality organic halides to support your research and industrial applications, ensuring reliable and effective performance in your synthetic and analytical projects.
Subcategories of "Organic Halides"
Found 20437 products of "Organic Halides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H98N16O15SPurity:Min. 95%Molecular weight:1,507.76 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/molN,N-Dimethyl-1,1,2,2-tetrafluoroethylamine
CAS:<p>Dimethyl 1,1,2,2-tetrafluoroethylamine (DMTFEA) is a fluorinated compound that contains a cyclohexane ring. It can be synthesized using pyrazoles and reaction solution. DMTFEA has functional groups such as halides, fluorine and chlorine. DMTFEA is acidic and has the structural formula of CF3CF=N-CH2CH2COOH. This chemical can also be synthesized by reacting chloroacetic acid with dimethylamine. The pharmacokinetic properties of DMTFEA are not well-known, but it does have ester compounds that are synthetic in nature.</p>Formula:C4H7F4NPurity:Min. 95%Molecular weight:145.1 g/molH-D-Pro-Pro-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/mol3’’’-Epi-Empagliflozin
CAS:<p>Please enquire for more information about 3’’’-Epi-Empagliflozin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27ClO7Purity:95% MinColor and Shape:PowderMolecular weight:450.91 g/mol(R)-methyl pyrrolidine-3-carboxylate hydrochloride
CAS:<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%APL1b25 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H166N28O35SPurity:Min. 95%Molecular weight:2,328.6 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/mol2-Aminoindole hydrochloride
CAS:<p>2-Aminoindole hydrochloride is a heterocyclic amine that is formed by the reaction of benzene and an aminoindole. It is a difunctional compound that can react with alcohols to form amides, carbonyl groups to form ketones, or carbamate groups to form ureas. This compound has been shown to act as an activated aromatic amine that reacts with oxygen in the atmosphere to form a variety of products, including chlorinated aromatic amines. 2-Aminoindole hydrochloride has been shown to have carcinogenic effects in rats when administered orally at high doses.</p>Formula:C8H9ClN2Purity:Min. 95%Color and Shape:Slightly Yellow PowderMolecular weight:168.62 g/mol1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole
CAS:<p>1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole is an organic compound that is used in the synthesis of carboxylic acid derivatives. It is a synthetic intermediate, which can be converted to other compounds by intramolecular hydrogen bonding. The efficiency of this method has been shown through a number of experiments. In nature, 1-methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole may be found as a hydrogen bond donor.</p>Formula:C7H5Cl3N2O3Purity:Min. 95%Molecular weight:271.48 g/molGastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C214H324N58O63SPurity:Min. 95%Molecular weight:4,749.28 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H86N14O13SPurity:Min. 95%Molecular weight:1,087.34 g/molH-Gly-Arg-bNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Gly-Arg-bNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H24N6O2Purity:Min. 95%Molecular weight:356.42 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molL-Cystine dihydrochloride
CAS:<p>L-Cystine dihydrochloride is a chemical compound that is used as an amino acid. It has biological properties that are due to its ability to inhibit pancreatic lipase and l-threonine. L-Cystine dihydrochloride has been shown to have anti-infectious effects against a number of bacterial and viral diseases, including HIV, herpes simplex virus, and influenza. L-Cystine dihydrochloride is also used in cell culture experiments because it can be used to break disulfide bonds in proteins.</p>Formula:C6H14Cl2N2O4S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:313.22 g/mol(Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H203N37O30SPurity:Min. 95%Molecular weight:2,796.3 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H70N12O20Purity:Min. 95%Molecular weight:1,195.19 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/molPAR-2 (1-6) (human) trifluoroacetate salt
CAS:<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/mol1-Hydroxy-6-(Trifluoromethyl)Benzotriazole
CAS:<p>1-Hydroxy-6-(trifluoromethyl)benzotriazole is a chemical compound that is used as a reagent and an additive in organic synthesis. It has been shown to react with the 7-aminocephalosporanic acid to form a reactive molecule, which is then acylated with various amines. The reaction time can be modified by adding certain additives, such as chloride or uridine. 1-Hydroxy-6-(trifluoromethyl)benzotriazole is also a solid phase synthesis, which means it reacts with other molecules during the synthesis process to form new substances. It also has acidic properties, and can act as a nucleophile in the presence of aminocephalosporanic acid. The structural formula for this chemical is shown below:</p>Formula:C7H4F3N3OPurity:Min. 95%Molecular weight:203.12 g/mol1-Benzyl-4-bromo-1H-pyrazole
CAS:<p>1-Benzyl-4-bromo-1H-pyrazole is a pyrazole derivative that can be synthesized from 1,2,3-triazoles and bromine. It undergoes arylation reactions in the presence of copper to form aryl derivatives. It is also catalytic mediated with alkyl halides to form c–h bond cleavage products. This compound reacts with tribromide to form an alkylation product. The ligand is activated by arylations and alkylations. It is used as a reagent in organic chemistry for the synthesis of pyrazole derivatives.</p>Formula:C10H9BrN2Purity:Min. 95%Molecular weight:237.1 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molH-Gly-Gly-AMC hydrochloride salt
CAS:<p>H-Gly-Gly-AMC is a fluorescent substrate for the detection of protease activity. It can be used in a homogeneous assay to measure the protease activity of cells. The assay provides an accurate measurement of protease activity and the ability to normalize data to account for differences in cell number and protein content. H-Gly-Gly-AMC hydrochloride salt (HGG) is also a fluorogenic substrate for the determination of cell death or damage, which can be measured using aminoluciferin. This assay is based on the release of aminoluciferin from lysed cells, which fluoresces in proportion to the amount released.</p>Formula:C14H15N3O4Purity:Min. 95%Molecular weight:289.29 g/molNeuropeptide Y (18-36) trifluoroacetate salt
CAS:<p>Neuropeptide Y (18-36) trifluoroacetate salt H-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg -Gln is a peptide belonging to the family of neuropeptides. It has been shown to have potent vasoconstricting activity in rat and guinea pig hearts, as well as contractile activity in rat aortic rings. Neuropeptide Y (18 - 36) trifluoroacetate salt H -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifl uoroacetate salt also inhibits the cyclase activity of adenylate cyclase, which is responsible for generating the second messenger cAMP. This compound may be used to treat congest</p>Formula:C112H174N36O27Purity:Min. 95%Molecular weight:2,456.81 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Formula:C11H16ClNO3Purity:Min. 95%Color and Shape:White to off white solid.Molecular weight:245.7 g/mol3-Fluoro-4-nitrobenzoic acid
CAS:<p>3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molEthyl 4-bromoacetoacetate
CAS:<p>Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.</p>Formula:C6H9BrO3Purity:90%NmrMolecular weight:209.04 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/mol5-Bromoquinolin-6-amine
CAS:<p>Please enquire for more information about 5-Bromoquinolin-6-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H7BrN2Purity:Min. 95%Molecular weight:223.07 g/mol3,5-Diiodo-4-hydroxybenzhydrazide
CAS:<p>3,5-Diiodo-4-hydroxybenzhydrazide is a chemical compound that is useful as a building block in organic synthesis. It is a versatile intermediate and can be used in the preparation of heterocyclic compounds and pharmaceuticals. 3,5-Diiodo-4-hydroxybenzhydrazide reacts with alkyl halides to form alkyl iodides, which are important reagents for organic synthesis. 3,5-Diiodo-4-hydroxybenzhydrazide has been used as an effective reagent for the formation of new carbon–carbon bonds and has been shown to be an excellent starting point for the synthesis of biologically active molecules.</p>Formula:C7H6I2N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:403.94 g/molBromofluoroacetic Acid
CAS:<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>Formula:C2H2BrFO2Purity:Min. 95%Molecular weight:156.94 g/molTris[4-(trifluoromethyl)phenyl]phosphine
CAS:<p>Tris[4-(trifluoromethyl)phenyl]phosphine (TFPP) is a diphosphine ligand that binds to metal ions in the active site of enzymes. It has been shown to bind to methylenecyclopropanes, which are intermediates in the reaction of Grignard reagents with quinoline derivatives. TFPP is also able to form complexes with phosphines and other ligands, such as borane. The crystal structures of TFPP have been determined by x-ray diffraction studies. These structures show that TFPP is monosubstituted with four trifluoromethyl groups and one phosphorus atom.br>br> TFPP has also been shown to be an effective catalyst for reactions involving amides, such as hydroamination and acylation reactions. In addition, it was found that TFPP inhibits the growth of bacteria by inhibiting</p>Formula:C21H12F9PPurity:Min. 95%Color and Shape:SolidMolecular weight:466.28 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Formula:C148H239ClN44O42Purity:Min. 95%Molecular weight:3,342.21 g/molZ-Asp(OtBu)-bromomethylketone
CAS:<p>Please enquire for more information about Z-Asp(OtBu)-bromomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H22BrNO5Purity:Min. 95%Molecular weight:400.26 g/mol8-Desmethoxy-8-fluoro moxifloxacin
CAS:<p>8-Desmethoxy-8-fluoro moxifloxacin is a photolytic drug that is used to treat bacterial infections. It has a high degree of antibacterial activity against methicillin-resistant staphylococcus aureus, including methicillin resistant strains of Staphylococcus epidermidis. 8-Desmethoxy-8-fluoro moxifloxacin hydrochloride is produced by the addition of hydrochloric acid to moxifloxacin, which is then purified by ion chromatography. The compound has been shown to have good stability in human plasma and urine. It also shows excellent recoveries in acetonitrile and quantification results in flow rates.</p>Formula:C20H21F2N3O3Purity:Min. 95%Molecular weight:389.4 g/mol2,4-Dichloro-5-methoxyaniline
CAS:<p>2,4-Dichloro-5-methoxyaniline (2,4-DMA) is a trifluoroacetic acid derivative that inhibits the growth of cancer cells by interfering with cellular processes such as DNA replication and protein synthesis. It has been shown to have anticancer activity in vitro and in vivo. In addition, 2,4-DMA can inhibit the growth of cancer cells by preventing epidermal growth factor from binding to its receptor on the cell surface. A recent study showed that 2,4-DMA has anti-angiogenic properties and can prevent tumor growth by inhibiting bcr-abl kinase activity. 2,4-DMA also has an acidic property which may be due to its conversion of trifluoroacetic acid into hydrogen fluoride (HF) and hydrogen chloride (HCl).<br>2,4-Dichloro-5-methoxyaniline was approved for use in Japan</p>Formula:C7H7Cl2NOPurity:Min. 95%Color and Shape:White To Pink SolidMolecular weight:192.04 g/molBoc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-(4-Fluorobenzoyl)propionic acid
CAS:<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>Formula:C10H9FO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:196.18 g/mol2-(4,4-Difluorocyclohex-1-en-1-yl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane
CAS:<p>Please enquire for more information about 2-(4,4-Difluorocyclohex-1-en-1-yl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19BF2O2Purity:Min. 95%Molecular weight:244.09 g/mol6-Chloroindole-3-carboxaldehyde
CAS:<p>6-Chloroindole-3-carboxaldehyde is a natural compound with the molecular formula C8H6ClNO2. It has been shown to have anticancer activity against lung cancer cells and has been found to inhibit the growth of metastatic lung cancer cells in mice. 6-Chloroindole-3-carboxaldehyde inhibits the proliferation of human lung cancer cells by arresting cells in the G1 phase of the cell cycle, which may be due to its ability to bind to deoxyhexose and form a complex. This compound also has antimicrobial activity against bacterial strains such as Streptococcus pneumoniae and Mycoplasma pneumoniae.</p>Formula:C9H6ClNOPurity:Min. 95%Molecular weight:179.6 g/molBNP-45 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-45 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C209H354N70O63S2Purity:Min. 95%Molecular weight:4,919.61 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/mol4-Chloro-Nicotinic acid ethyl ester hydrochloride
CAS:<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>Formula:C8H8ClNO2·HClPurity:Min. 95%Molecular weight:222.07 g/mol(Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H296N54O56Purity:Min. 95%Molecular weight:4,292.77 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molH-Lys-Ala-Pro-OH hydrochloride salt
<p>Please enquire for more information about H-Lys-Ala-Pro-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N4O4Purity:Min. 95%Molecular weight:314.38 g/mol4-Fluoro-2-methoxy-5-nitroaniline
CAS:<p>Intermediate in the synthesis of osimertinib (AZD9291)</p>Formula:C7H7FN2O3Purity:Min. 95%Molecular weight:186.14 g/molVIP (3-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H226N40O39SPurity:Min. 95%Molecular weight:3,101.58 g/molAlarin (human) trifluoroacetate salt
CAS:<p>Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.</p>Formula:C127H205N43O35Purity:Min. 95%Molecular weight:2,894.26 g/mol3-Aminoazepan-2-one hydrochloride
CAS:<p>Please enquire for more information about 3-Aminoazepan-2-one hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O•HClPurity:Min. 95%Molecular weight:164.63 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molOsteoblast Activating Peptide (human) trifluoroacetate salt
<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37SPurity:Min. 95%Molecular weight:2,795.14 g/molDipivefrin hydrochloride
CAS:<p>Dipivefrin hydrochloride is a drug that belongs to the class of prostaglandin analogues. It is used as a topical ophthalmic solution for the treatment of glaucoma and other intraocular disorders. Dipivefrin hydrochloride is not active against microbial infection or choroidal neovascularization, but has been shown to be effective in the pharmacological treatment of metabolic disorders. This drug interacts with the prostaglandin receptors in the eye, which can lead to increased production of cyclic GMP (cGMP), a second messenger that causes relaxation of smooth muscles in blood vessels and leads to decreased intraocular pressure. Dipivefrin hydrochloride also has antimicrobial properties due to its ability to inhibit bacterial growth through binding with microbial cell membranes, thereby inhibiting protein synthesis.</p>Formula:C19H30ClNO5Purity:Min. 95%Molecular weight:387.9 g/mol4-Bromobenzene-1,2-diol
CAS:<p>4-Bromobenzene-1,2-diol is a reactive substance that has been shown to have receptor binding and reaction intermediates. It has been shown to inhibit the formation of reactive oxygen species in rat liver microsomes. The formation rate of 4-bromobenzene-1,2-diol is increased by carbon source such as bromobenzene. This substance has also been shown to be an inhibitor of the reaction mechanism. 4-Bromobenzene-1,2-diol is used as a reactant in organic synthesis reactions and can be found in dry weight measurements.</p>Formula:C6H5BrO2Purity:Min. 95%Molecular weight:189.01 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/mol(S)-(+)-6,6'-Dibromo-1,1'-bi-2-naphthol
CAS:<p>Used in the synthesis of 6,6'-substituted BINOL chiral ligands</p>Formula:C20H12Br2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:444.12 g/mol(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N15O10Purity:Min. 95%Molecular weight:1,122.32 g/molSomatostatin-14 (3-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H96N16O17S2Purity:Min. 95%Molecular weight:1,509.75 g/mol(D-Ser4)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molBoc-Val-Pro-Arg-AMC
CAS:<p>Please enquire for more information about Boc-Val-Pro-Arg-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H45N7O7Purity:Min. 95%Molecular weight:627.73 g/mol(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molMethyl 3-chloro-4-fluorobenzoate
CAS:<p>Methyl 3-chloro-4-fluorobenzoate is a white crystalline solid with a melting point of 61°C. It is soluble in ethyl acetate, ether, and chloroform. Methyl 3-chloro-4-fluorobenzoate is used as a reagent in the synthesis of polymers, pharmaceuticals, and pesticides. It has been shown to be useful as a building block for the synthesis of complex compounds such as heterocycles and polymers. Methyl 3-chloro-4-fluorobenzoate is also used as an intermediate in the production of other chemicals such as pharmaceuticals, catalysts, and herbicides.</p>Formula:C8H6ClFO2Purity:Min. 95%Molecular weight:188.58 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H270N48O51S2Purity:Min. 95%Molecular weight:4,046.55 g/mol2-[3-(S)-[3-(2-(7-Chloro-2-quinolinyl)ethenyl)phenyl]-3-hydroxypropyl]benzoic acid methyl ester
CAS:<p>2-[3-(S)-[3-(2-(7-Chloro-2-quinolinyl)ethenyl)phenyl]-3-hydroxypropyl]benzoic acid methyl ester is a synthetic compound that can be used as a reagent in the synthesis of polynucleotides and polypeptides. It can also be used as an inhibitor of ketoreductase, which is an enzyme involved in the synthesis of fatty acids and ketones. 2-[3-(S)-[3-(2-(7-Chloro-2-quinolinyl)ethenyl)phenyl]-3-hydroxypropyl]benzoic acid methyl ester has been shown to inhibit the growth of wild type and mutant strains of E. coli. The molecular weight of this compound is 439.</p>Formula:C28H24ClNO3Purity:Min. 95%Molecular weight:457.95 g/mol5'-Fluoro-2'-hydroxyacetophenone
CAS:<p>5'-Fluoro-2'-hydroxyacetophenone is a synthetic compound that has been shown to inhibit the growth of human pathogens. It is an antimicrobial agent that can be used as an alternative to antibiotics for the treatment of bacterial infections. 5'-Fluoro-2'-hydroxyacetophenone was synthesized by means of an asymmetric synthesis from 5-fluoro-2-methoxybenzaldehyde, which had been obtained through a chemical study. The functional group that this compound belongs to is amide and it has acidic, sulphonate, and vibrational properties. Hydrochloric acid can demethylate this compound to produce 2-hydroxyacetophenone, which can be converted into 2-methylpropionaldehyde by methylation.</p>Formula:C8H7FO2Purity:Min. 95%Molecular weight:154.14 g/mol5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H138N34O18Purity:Min. 95%Molecular weight:1,972.27 g/mol(Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H158N32O23S2Purity:Min. 95%Molecular weight:2,192.62 g/mol(Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H287N55O57SPurity:Min. 95%Molecular weight:4,285.71 g/mol5-Chlorovanillin
CAS:<p>5-Chlorovanillin is a polymerase chain inhibitor that inhibits the activity of the enzyme ribonucleotide reductase. This inhibition leads to a decrease in the production of RNA and DNA, which in turn affects the transcription and replication of the bacterial DNA. 5-Chlorovanillin has been shown to have inhibitory effects on protein synthesis and cell division, as well as antimicrobial properties. It has a redox potential of -0.2 V at pH 7, making it an ideal candidate for electrochemical impedance spectroscopy (EIS).</p>Formula:C8H7ClO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:186.59 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/mol(Dibromomethyl)benzene
CAS:<p>Dibromomethylbenzene is a reactive, non-metallic chemical compound with the formula CHBr2. It is a colorless liquid that is soluble in water and has a strong odor. Dibromomethylbenzene can be used to treat wastewater by removing metals, such as iron and copper, that are not removed by conventional methods. This compound also has been shown to inhibit the growth of infectious bacteria, such as Salmonella enterica and Escherichia coli. Dibromomethylbenzene reacts with metal hydroxides to produce volatile bromide ions, which react with the carbohydrate to form cyclic peptides. These reactions are catalyzed by solid catalysts like activated carbon or alumina.</p>Formula:C7H6Br2Purity:95%MinMolecular weight:249.93 g/molBoc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt
CAS:<p>Please enquire for more information about 4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H6Cl2Na2O8S3Purity:Min. 95 Area-%Color and Shape:White Off-White PowderMolecular weight:491.25 g/molTetrabromophenol blue sodium salt
CAS:<p>Tetrabromophenol blue sodium salt is a dye that is used as an additive in the production of vinyl alcohol polymer films. Tetrabromophenol blue sodium salt can be used to measure albumin concentration and postexposure by adding phenyl groups to the molecule. The color of tetrabromophenol blue sodium salt changes upon exposure to radiation, which makes it useful for diagnostic purposes. It also has a hydrocarbon group that transforms into an insoluble form when exposed to evaporation, making it useful for titration methods. Tetrabromophenol blue sodium salt is relatively stable and labile in nature, making it susceptible to techniques such as pyrolysis, oxidation, or reduction.</p>Formula:C19H5Br8NaO5SPurity:Min. 95%Molecular weight:1,007.53 g/mol9-Fluorenone hydrazone
CAS:<p>9-Fluorenone hydrazone is a compound that belongs to the group of chemical compounds known as heterocycles. It can be synthesized by reacting 9-fluorenone with hydrazine. The synthesis proceeds via an intramolecular hydrogen transfer reaction, which forms an unsymmetrical aldehyde. This aldehyde is oxidized to form the corresponding hydrazone through protonation and subsequent attack of a nitrogen nucleophile. Hydrazones are important for their antimicrobial properties and are used in the treatment of bacterial infections such as tuberculosis and leprosy. They are also used in the production of dyes and pharmaceuticals. The mechanism for this reaction involves the formation of an intermediate carbocation, followed by deprotonation to form the final product.</p>Formula:C13H10N2Purity:Min. 95%Color and Shape:Yellow PowderMolecular weight:194.23 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/molNeuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H180N32O38Purity:Min. 95%Molecular weight:2,558.8 g/mol5-Chloro-8-hydroxyquinoline
CAS:<p>5-Chloro-8-hydroxyquinoline (5-CQ) is a quinoline derivative that has been used as an anticancer agent. It binds to DNA and inhibits the synthesis of RNA and proteins, leading to cell death. 5-CQ has been shown to be cytotoxic against skin cells in vitro by inhibiting mitochondrial oxidative phosphorylation and decreasing the mitochondrial membrane potential. This compound also has genotoxic effects on cultured choroidal neovascularization cells through the inhibition of DNA synthesis.<br>5-CQ binds to DNA via hydrogen bonds with nitrogen atoms in the purine ring of nucleobases. The overall geometry is that of a distorted octahedron with two faces, each containing six nitrogens in square planar coordination geometry. The binding constants are low for purines but high for pyrimidines, which is why 5-CQ preferentially targets purine rich regions of the genome.</p>Formula:C9H6ClNOPurity:Min. 95%Color and Shape:Green To Grey SolidMolecular weight:179.6 g/molDiphenyl(4-phenylthio)phenylsufonium hexafluorophosphate
CAS:<p>Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate is a photoinitiator that is used in photopolymerization. It absorbs light at around 800 nm and emits light at around 810 nm. The initiator has a low molecular weight and is soluble in organic solvents, which makes it suitable for polymerization of acrylate monomers. Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate can be synthesized by the reaction of diphenyliodonium hexafluorophosphate with phenyldithiocarbonyl chloride.</p>Formula:C24H19S2•PF6Purity:Min. 95%Color and Shape:PowderMolecular weight:516.5 g/molH-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Fluoroanisole
CAS:<p>2-Fluoroanisole is an organic compound that is used in organic synthesis as a chiral auxiliary. It has been shown to inhibit the growth of cancer cells by binding to nucleophilic sites on the cell and preventing the formation of new proteins. 2-fluoroanisole is synthesized through a two-step process that begins with the asymmetric synthesis of the desired chiral molecule using a chiral catalyst and deuterium isotope. The second step involves converting 2-fluoroanisole into its more stable form, dodecanedioic acid, by treating it with hydrochloric acid or trifluoroacetic acid. The structural analysis of this molecule revealed that it contains two nucleophilic substitutions, which are likely responsible for its inhibitory properties.</p>Formula:C7H7FOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:126.13 g/mol2,2,2-Trifluoro-1-(3-Trimethylsilylphenyl)Ethanone
CAS:<p>2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone is a chemical that can be used as an acetylcholinesterase inhibitor. This agent is designed to inhibit the enzyme that breaks down acetylcholine, which is responsible for transmitting nerve impulses and controlling muscle contractions. The activity of 2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone is reversible by hydrolysis and it has a low bioavailability due to its high lipophilicity. Acetylcholinesterase inhibitors are mainly used for the treatment of inflammatory diseases such as rheumatoid arthritis. br> The pharmacodynamics of 2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone are not well understood. This drug also has side effect profiles</p>Formula:C11H13F3OSiPurity:Min. 95%Molecular weight:246.3 g/molCinchonine Hydrochloride Hydrate
CAS:<p>Cinchonine hydrochloride hydrate is a compound that belongs to the class of amines. It is used as an anti-malarial drug, an anti-arrhythmic agent, and a vasodilator. Cinchonine hydrochloride hydrate has been shown to be heat resistant and can be used in pharmaceutical preparations such as gel permeation chromatography. This compound also has a catalytic effect on reactions with glycerin and piperidone, which are used in the production of various dyes. Cinchonine hydrochloride hydrate can also be used as a solid catalyst for viscosity measurements in wastewater treatment plants.</p>Formula:C19H22N2O·HCl·xH2OPurity:Min. 95%Molecular weight:330.85 g/mol5-Chloro-2-nitrodiphenylamine
CAS:<p>5-Chloro-2-nitrodiphenylamine is a synthetic dyestuff that belongs to the class of acridones. It can be used as an anti-epileptic drug, although it has not been approved for this use in any country. 5-Chloro-2-nitrodiphenylamine is manufactured by reacting a 6-carboxylic acid with an organic solvent and ammonolysis. This chemical is also known as 6'-chloroacridone and is used in the production of dyes and pigments. The manufacturing process produces impurities such as chloride, which must be removed by evaporation. Nitro groups are introduced during the manufacturing process to improve the dye's stability and color fastness under light exposure.</p>Formula:C12H9ClN2O2Purity:Min. 95%Color and Shape:Orange To Red SolidMolecular weight:248.66 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molImidazo[1,2-a]pyridin-7-amine hydrobromide
CAS:<p>Please enquire for more information about Imidazo[1,2-a]pyridin-7-amine hydrobromide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H8BrN3Purity:Min. 95%Molecular weight:214.06 g/molAQEE-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C157H252N48O56Purity:Min. 95%Molecular weight:3,707.97 g/mol(R)-2-Methylmorpholine hydrochloride
CAS:<p>Please enquire for more information about (R)-2-Methylmorpholine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H12ClNOPurity:Min. 95%Molecular weight:137.61 g/mol2-Amino-1-phenylpropan-1-one hydrochloride
CAS:Controlled Product<p>2-Amino-1-phenylpropan-1-one hydrochloride is a chemical compound that can be used as an intermediate in the synthesis of ethyl formate. It is also a pharmaceutical intermediate, which is used to prepare triazine and alicyclic compounds. It has been shown to have potential use in the treatment of prostatic hypertrophy and heterocycle disorders. 2-Amino-1-phenylpropan-1-one hydrochloride has been found to be active in animals and humans and is not toxic to women or animals. This drug has shown no adverse effects on human health at doses up to 10 g/kg body weight.</p>Formula:C9H11NO•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:185.65 g/molOrphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H195N37O37Purity:Min. 95%Molecular weight:2,832.13 g/mol3-Bromopyridazine
CAS:<p>3-Bromopyridazine is a dechlorinated derivative of pyridazine that has been used as an agrochemical. 3-Bromopyridazine can be synthesized by aminocarbonylation at the 3-position, which is a nucleophilic substitution reaction. It has been shown to yield high yields and to react with nucleophiles such as chlorine or heterocycles such as cinnoline. 3-Bromopyridazine can also be obtained by cross coupling of 2-bromoacetophenone with benzaldehyde and pyridine in the presence of copper. The resulting product is then reacted with sodium nitrite in hydrochloric acid to produce 3-bromopyridazine. This compound may have potential use as a chemical intermediate for other compounds, due to its chemical stability and its ability to undergo cross coupling reactions.</p>Formula:C4H3BrN2Purity:Min. 95%Molecular weight:158.98 g/mol4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa
CAS:<p>Please enquire for more information about 4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H19F2NO2Purity:Min. 95%Molecular weight:295.32 g/mol(Trifluoromethylthio) Silver(I)
CAS:<p>(Trifluoromethylthio) silver(I) is an efficient method for the synthesis of chiral, functionalized organosulfur compounds. It is prepared by the trifluoromethylthiolation of aryl acetonitriles in the presence of persulfate and a radical coupling agent. The reaction time can be adjusted to suit the desired product, with shorter times producing more complex molecules. This compound can be used as a nucleophile in organic reactions, including sulfide activation reactions.</p>Formula:CHAgF3SPurity:Min. 95%Molecular weight:209.95 g/mol6-Bromonaphthalen-1-ol
CAS:<p>6-Bromonaphthalen-1-ol is a compound that has shown antimicrobial and antifungal activity. It is the most potent of the naphthoxazines tested to date, with an MIC of 0.04 µg/ml against Escherichia coli. 6-Bromonaphthalen-1-ol was synthesized by reacting 1,2,4-trihydroxybenzene with bromine gas in the presence of mercuric chloride catalyst. The compound was hydrolyzed for elemental analysis and found to be C7H4BrO. Elemental analysis yielded a weight percentage of 71% carbon, 13% hydrogen, 3% bromine, and 12% oxygen. The x-ray diffraction pattern showed peaks at 2θ values of 22.3° (100), 26.5° (101), 33.7° (102), 40° (104), 44° (105) and 62°</p>Formula:C10H7BrOPurity:Min. 95%Molecular weight:223.07 g/mol(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS:<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formula:C47H67N11O11S2Purity:Min. 95%Molecular weight:1,026.23 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molGLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H252N44O48S•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,652.1 g/mol3-(3,4-dichlorophenyl)propanoic acid
CAS:<p>3-(3,4-Dichlorophenyl)propanoic acid is a potent inhibitor of the lysine methyltransferase enzyme. This enzyme catalyzes the transfer of methyl groups from S-adenosylmethionine to lysine residues in proteins, and it is involved in cancer cell proliferation. 3-(3,4-Dichlorophenyl)propanoic acid inhibits the activity of this enzyme by covalently binding to lysine residues on the protein and preventing their methylation. Research has shown that 3-(3,4-Dichlorophenyl)propanoic acid can block tumor growth by inhibiting the activity of this enzyme.</p>Formula:C9H8O2Cl2Purity:Min. 95%Color and Shape:PowderMolecular weight:219.06 g/mol2-Bromo-6-methylpyridine-3-carboxaldehyde
CAS:<p>2-Bromo-6-methylpyridine-3-carboxaldehyde (BMPCA) is a pharmacological agent that belongs to the group of antagonists. It has been shown to be a potent antagonist at the NMDA receptor and may be used for treating neuropathic pain. BMPCA also has been shown to have competitive inhibition at the naphthyridine receptor, which may allow it to act as an antagonist or an agonist depending on its binding site. The regioisomeric analogs of BMPCA are 2-(2,5-dichloropyridyl)-6-methylpyridine-3-carboxaldehyde and 2-(2,5-dimethylpyridyl)-6-methylpyridine-3-carboxaldehyde. These analogs have been shown to inhibit the growth of tumor cells in vitro and in vivo.</p>Formula:C7H6BrNOPurity:Min. 95%Molecular weight:200.03 g/mol9,9-Dioctyl-7-dibromofluorene
CAS:<p>9,9-Dioctyl-7-dibromofluorene is a linear polymer with an ethylene diamine backbone. It is a synthetic material that can be used for devices such as solar cells. 9,9-Dioctyl-7-dibromofluorene has been shown to have efficient light emission properties and high optical absorption in the visible region of the electromagnetic spectrum. The device efficiency of this material has been shown to be improved by substituent effects and reaction time.</p>Formula:C29H40Br2Purity:Min. 95%Molecular weight:548.44 g/mol2-Chloro-3,5-dinitrobenzotrifluoride
CAS:<p>2-Chloro-3,5-dinitrobenzotrifluoride is a chemical compound that is used as an intermediate in the synthesis of dyes and pharmaceuticals. It reacts with nitrous acid to form 2-chloro-3,5-dinitrobenzoic acid. The hydrogen bond between the hydroxyl group and the chlorine atom in this compound is weak, which leads to a constant value for its spectrometer. This chemical compound has photophysical properties that are dependent on the concentration of solutes. When it is mixed with other solutes such as potassium ion or sulfoxide, it can produce isomers. This chemical compound can be refluxed in a neutral pH environment to form anilines and acetonitrile, two compounds that are important for organic synthesis.</p>Formula:C7H2ClF3N2O4Purity:Min. 95%Color and Shape:Light (Or Pale) Yellow To Yellow SolidMolecular weight:270.55 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H63N15O13Purity:Min. 95%Molecular weight:1,082.13 g/molH-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution)
<p>Please enquire for more information about H-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-β-iodo-Ala-OMe
CAS:<p>Boc-beta-iodo-Ala-OMe is a hydrophobic reagent that can be used in peptide synthesis. It can be used in organic solvents, such as methyl ester, to synthesize homologues of amino acids and amino acid derivatives. Boc-beta-iodo-Ala-OMe is an electrophile that reacts with a nucleophile to produce the corresponding enantiomeric product. The hydrophobic nature of this reagent makes it useful for reactions involving solvents with low polarity, such as halides and alcohols.</p>Formula:C9H16INO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:329.13 g/mol2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene
CAS:<p>2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene is a chemical compound that is used as a sensor for electron transfer in organic molecules. When the molecule is oxidized, the bromine atom is reduced to hydrogen bromide, which is able to conduct electricity. This allows it to be used as a sensing electrode to measure electron transfer in organic molecules. 2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene has been synthesized using experimental techniques and geometry experiments. The transport of electrons can be measured using electrodes with tripodal geometry with nanoscale dimensions.</p>Formula:C15H12BrIPurity:95%NmrMolecular weight:399.06 g/molH-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt
CAS:<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>Formula:C26H42N8O8Purity:Min. 95%Molecular weight:594.66 g/molGLP-2 (1-34) (human) trifluoroacetate salt
CAS:<p>Structure/Function: human; Trifluoroacetate salt</p>Formula:C171H266N48O56SPurity:Min. 95%Molecular weight:3,922.3 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/molH-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Formula:C50H73N13O11Purity:Min. 95%Molecular weight:1,032.2 g/mol(Dab 9)-Neurotensin (8-13) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H60N10O8Purity:Min. 95%Molecular weight:760.92 g/mol(Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H83N13O14Purity:Min. 95%Molecular weight:1,042.23 g/mol3-Methylpentyl chloroformate
CAS:<p>Please enquire for more information about 3-Methylpentyl chloroformate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H13ClO2Purity:Min. 95%Molecular weight:164.63 g/molTribromomethyl phenyl sulfone
CAS:<p>Tribromomethyl phenyl sulfone is an alkylthio compound that has a cyclohexane ring and a hydroxy group. Tribromomethyl phenyl sulfone has high resistance to thermal expansion, hydrolysis, and radiation. It reacts with silver ions to form bromophenyl silver ion. This molecule can be formed through the reaction of diphenyl ether with hydrogen sulfide in the presence of light, or by the reaction of benzene with sodium hydroxide in the presence of light. Tribromomethyl phenyl sulfone is used as a stabilizer for plastics and other organic materials, as well as an antioxidant for rubber products.</p>Formula:C7H5Br3O2SPurity:Min. 95%Molecular weight:392.89 g/mol2-Aminoethanesulphonamide monohydrochloride
CAS:<p>2-Aminoethanesulphonamide monohydrochloride is a perovskite with a hexagonal shape. It has been shown to interact with the pharmacophore of the enzyme cytochrome P450, and it has been optimized for the reaction by altering its structure. This product is soluble in gaseous form, but can also be used as a solid. 2-Aminoethanesulphonamide monohydrochloride has an absorption maximum at 325 nm and emits fluorescence at 420 nm. It is used in devices that detect ionizing radiation.</p>Formula:C2H8N2O2S•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:160.62 g/molNeuromedin S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H307N57O49SPurity:Min. 95%Molecular weight:4,241.92 g/mol(Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/mol2-[(5-Chloropyridin-2-yl)amino]-2-oxoacetic acid ethyl ester monohydrochloride
CAS:<p>Intermediate in the synthesis of edoxaban</p>Formula:C9H9ClN2O3·HClPurity:Min. 95%Molecular weight:265.09 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N53O64SPurity:Min. 95%Molecular weight:4,552.13 g/mol2-Bromopropionitrile
CAS:<p>2-Bromopropionitrile is a chemical compound that is used in the production of nylon. The structure of 2-bromopropionitrile consists of a 6-carbon chain with two bromine atoms attached at either end. It has an n-dimethyl formamide group, which is an organic molecule containing nitrogen and carbon atoms. The 4-methoxybenzenesulfonyl chloride reacts with the 2-bromopropionitrile to give a diene, which has the formula CH=CHCHBr. This diene reacts with hydrochloric acid to produce hydrogen bromide gas and 2-bromopropionic acid. The activation energy for this reaction is 14 kilojoules per mole of reactants, which indicates that it should be carried out at high temperatures and pressures. Halides are able to act as nucleophiles in coordination chemistry because they have lone pairs on their outermost electron shell. Cation</p>Formula:C3H4BrNPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:133.97 g/molAbz-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H58N12O16Purity:Min. 95%Molecular weight:986.98 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H217N47O41S4Purity:Min. 95%Molecular weight:3,306.75 g/mol1,1-Dibromo-2,2-bis(chloromethyl)cyclopropane
CAS:<p>1,1-Dibromo-2,2-bis(chloromethyl)cyclopropane is a synthetic chemical that can be used to synthesize lactams. It is a member of the class of enolates and has two isomers: sulfoxide and sulfone. The synthesis process begins with an amination reaction between 1,1-dibromo-2,2-bis(chloromethyl)cyclopropane and an amine in the presence of magnesium chloride. This reaction produces a sulfide intermediate that reacts with an aldehyde or ketone to form the desired lactam. The reaction time varies depending on the reactivity of the reactants, but it typically takes less than one hour at room temperature. Magnesium metal is needed as a catalyst for this reaction because it will not take place without it. 1,1-Dibromo-2,2-bis(chloromethyl)cyclopropane also reacts easily</p>Formula:C5H6Br2Cl2Purity:Min. 95%Molecular weight:296.81 g/mol6-Fluoro-3,4-Pyridinediamine
CAS:<p>Please enquire for more information about 6-Fluoro-3,4-Pyridinediamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H6FN3Purity:Min. 95%Molecular weight:127.12 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/molDi-tert-butylchlorophosphine
CAS:<p>Di-tert-butylchlorophosphine is a nucleophilic reagent used for the cross-coupling of aryl chlorides. It reacts with an amine to produce an imine, which can be hydrolyzed to form an amide. Di-tert-butylchlorophosphine is typically used in palladium-catalyzed coupling reactions and can react with ethene, propene, and butadiene to produce ethylbenzene, propenal, and butadienal. This compound also has been used as a precursor in the preparation of antiviral drug Covid®19. The reaction temperature for this compound is typically between -40°C and 0°C.</p>Formula:C8H18ClPPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:180.65 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/molFlunarizine dihydrochloride
CAS:<p>T-type calcium channel inhibitor</p>Formula:C26H28Cl2F2N2Purity:Min. 95%Color and Shape:PowderMolecular weight:477.42 g/mol5'-Bromo-2'-hydroxypropiophenone
CAS:<p>5'-Bromo-2'-hydroxypropiophenone is a synthetic compound that inhibits the dimerization of survivin, which is a protein involved in cancer pathways. This compound has been shown to inhibit the growth of cells in culture and can be used as an inhibitor for assays. 5'-Bromo-2'-hydroxypropiophenone has also been shown to integrate into DNA, which may lead to chromosomal rearrangements and mutations. It also binds with high affinity to the family of modifications borealin, which are implicated in cellular processes such as cell differentiation and proliferation.</p>Formula:C9H9BrO2Purity:Min. 95%Color and Shape:SolidMolecular weight:229.07 g/molH-Arg-Pro-pNA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O4Purity:Min. 95%Molecular weight:391.43 g/molDichloro(pentamethylcyclopentadienyl)iridium(III) dimer
CAS:<p>Dichloro(pentamethylcyclopentadienyl)iridium(III) dimer (DCPI) is a synthetic ligand that can be used in biomolecular and chemical applications. DCPI has been shown to be stable in the presence of chloride, which is needed for many catalytic reactions. This compound has high activity as a transfer agent and is also able to transfer amines and cyclic compounds. DCPI can be used in fluorescence-based assays, due to its strong fluorescence emission.</p>Formula:C20H30Cl4Ir2Purity:Min. 95%Color and Shape:PowderMolecular weight:796.7 g/molGalacto-RGD trifluoroacetate salt
CAS:<p>Please enquire for more information about Galacto-RGD trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H52N10O12Purity:Min. 95%Color and Shape:PowderMolecular weight:792.84 g/mol4-Chlorophenyl-2-pyridinylmethanol
CAS:<p>Please enquire for more information about 4-Chlorophenyl-2-pyridinylmethanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H10ClNOPurity:Min. 95%Molecular weight:219.67 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/molIodopolystyrene resin ,100-200 mesh
CAS:<p>Please enquire for more information about Iodopolystyrene resin ,100-200 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%GRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol4-Nitro-D-phenylalanine methyl ester hydrochloride
CAS:<p>Please enquire for more information about 4-Nitro-D-phenylalanine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O4·HClPurity:Min. 95%Molecular weight:262.69 g/mol(1S,4S)-2-Oxa-5-azabicyclo[2.2.1]heptane hydrochloride
CAS:<p>Please enquire for more information about (1S,4S)-2-Oxa-5-azabicyclo[2.2.1]heptane hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H10ClNOPurity:Min. 95%Molecular weight:135.59 g/mol2-Amino-4-fluorobenzaldehyde
CAS:<p>2-Amino-4-fluorobenzaldehyde is a plant growth regulator that has been shown to be effective at increasing the yield of flowers and fruit crops. It is used as an intermediate in the synthesis of agrochemicals, such as 2-aminobenzaldehyde and anthranilic acid. The biosynthesis of 2-amino-4-fluorobenzaldehyde starts from methanol and intermediates such as anthranilic acid, aminoaldehydes, or alcohols. It can also be produced by oxidative coupling of 2-aminobenzaldehyde with phenylacetone in the presence of sodium hydroxide. 2-Amino-4-fluorobenzaldehyde has been shown to be more efficient than other plant growth regulators such as robinia or aminocyclopentane carboxylic acid (ACC).</p>Formula:C7H6FNOPurity:Min. 95%Color and Shape:SolidMolecular weight:139.13 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/molH-His-His-OH trifluoroacetate salt
CAS:<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>Formula:C12H16N6O3Purity:Min. 95%Molecular weight:292.29 g/mol(β-Asp5)-δ-Sleep Inducing Peptide trifluoroacetate salt
CAS:<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>Formula:C35H48N10O15Purity:Min. 95%Molecular weight:848.81 g/mol(5-Bromo-2-methoxyphenyl)acetic acid
CAS:<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>Formula:C9H9BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:245.07 g/molAcetyl-α-MSH (11-13) hydrochloride salt
CAS:<p>Please enquire for more information about Acetyl-alpha-MSH (11-13) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H33N5O4Purity:Min. 95%Molecular weight:383.49 g/molH-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H71N11O12S2Purity:Min. 95%Molecular weight:1,166.37 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/mol3-[(Dimethylamino)methyl]-1,2,4-oxadiazol-5-amine hydrochloride
CAS:<p>3-[(Dimethylamino)methyl]-1,2,4-oxadiazol-5-amine hydrochloride is a versatile building block that is used as an intermediate in the synthesis of fine chemicals. It is also a useful scaffold for the synthesis of biologically active compounds and research chemicals. 3-[(Dimethylamino)methyl]-1,2,4-oxadiazol-5-amine hydrochloride can be prepared by reacting methylamine with 2-aminothiophenol in the presence of a base. This reagent is also useful for the preparation of other compounds such as carbamates and cyclic ureas.</p>Formula:C5H10N4O•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:178.62 g/molω-Agatoxin IVa trifluoroacetate
CAS:<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>Formula:C217H360N68O60S10Purity:Min. 95%Molecular weight:5,202.26 g/molZ-Tyr-Val-Ala-Asp-chloromethylketone
CAS:<p>Z-Tyr-Val-Ala-Asp-chloromethylketone is a fluorescent probe that can be used for the detection of phosphatidic acid. It is also an apoptosis inducer, which means that it promotes cell death. Z-Tyr-Val-Ala-Asp-chloromethylketone induces apoptosis by binding to the kinases and causing their activation, leading to phosphatidic acid production. This process is activated by the presence of ethylene, which binds to Z-Tyr-Val-Ala-Asp chloromethylketone and stabilizes its structure.</p>Formula:C30H37ClN4O9Purity:Min. 95%Molecular weight:633.09 g/mol4-bromo-5-chloro-2-fluorobenzoic Acid
CAS:<p>Please enquire for more information about 4-bromo-5-chloro-2-fluorobenzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H3BrClFO2Purity:Min. 95%Molecular weight:253.45 g/molBz-Phe-Val-Arg-AMC hydrochloride salt
CAS:<p>Bz-Phe-Val-Arg-AMC is a synthetic substrate that is used to measure proteolytic activity. It has been shown to be hydrolyzed by serine proteases, such as trypsin and chymotrypsin, at a rate proportional to the enzyme's concentration. The rate of hydrolysis was determined using a kinetic assay in which the release of AMC from the peptide bond was measured using an ultraviolet spectrophotometer. Bz-Phe-Val-Arg-AMC has also been used to study the effects of various food additives on proteolytic activity. This test can be used as a diagnostic tool for inflammatory diseases, such as Crohn's disease and ulcerative colitis.</p>Formula:C37H43N7O6Purity:Min. 95%Molecular weight:681.78 g/molNeuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C113H192N36O39Purity:Min. 95%Molecular weight:2,678.95 g/mol5'-(6-Fluorescein) phosphoramidite
CAS:<p>5'-(6-Fluorescein) phosphoramidite is an oligonucleotide that can be used to label other molecules. It is a synthetic, cellular moiety that functions as a glycoconjugate and binds to the receptor-mediated endocytosis pathway. It is taken up by cells via a mechanism involving hyaluronic acid, which is also involved in receptor-mediated endocytosis. 5'-(6-Fluorescein) phosphoramidite has been shown to have the ability to bind to disaccharides and form complexes with them. This property may be useful in studying the uptake of glycoconjugates into cells.</p>Formula:C46H58N3O10PPurity:Min. 95%Molecular weight:843.94 g/mol(Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H300N54O59S2Purity:Min. 95%Molecular weight:4,432.95 g/mol2-(2-Ethoxyphenoxy)ethyl bromide
CAS:<p>2-(2-Ethoxyphenoxy)ethyl bromide is a substance that is found as an impurity in the drug sulphonamide. It has been shown to be an optical isomer of methanol and ethanol, which have base form. The substance crystallizes in the form of white needles and its base form is tamsulosin hydrochloride. It has been used as a reagent for organic chemistry reactions, such as recrystallization, and as an impurity in organic solvents.</p>Formula:C10H13BrO2Purity:Min. 95%Molecular weight:245.11 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N10O18Purity:Min. 95%Molecular weight:1,023.05 g/molPreptin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H275N47O53Purity:Min. 95%Molecular weight:4,029.47 g/molSalusin-β (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C115H176N32O21Purity:Min. 95%Molecular weight:2,342.83 g/mol2-Chloro-3-methoxyphenol
CAS:<p>Please enquire for more information about 2-Chloro-3-methoxyphenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7ClO2Purity:Min. 95%Molecular weight:158.58 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H83N17O11Purity:Min. 95%Molecular weight:1,062.27 g/molSerpinin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Serpinin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H202N32O46Purity:Min. 95%Molecular weight:2,865.11 g/molAdrenomedullin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C242H381N77O75S5Purity:Min. 95%Molecular weight:5,729.42 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/mol(p-Iodo-Phe7)-ACTH (4-10)
CAS:<p>Please enquire for more information about (p-Iodo-Phe7)-ACTH (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H58IN13O10SPurity:Min. 95%Molecular weight:1,087.98 g/molo-Ethoxybenzoyl chloride
CAS:<p>O-Ethoxybenzoyl chloride is a pesticide that belongs to the group of sildenafil. It inhibits the activity of prolyl endopeptidase, an enzyme that degrades the peptide hormone vasoactive intestinal polypeptide (VIP). This inhibition prevents degradation of VIP, which is important for the regulation of blood vessel tone. The compound has been shown to be effective against Sclerotinia sclerotiorum and Claviceps purpurea. O-Ethoxybenzoyl chloride has been shown to have a high level of tolerance in plants and animals. It also has been found to be safe for humans with its low toxicity levels and low acute toxicity. It is not classified as hazardous by the World Health Organization (WHO).</p>Formula:C9H9ClO2Purity:Min. 95%Molecular weight:184.62 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/molACTH (1-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/mol5-Bromo-2-(trifluoromethoxy)benzaldehyde
CAS:<p>5-Bromo-2-(trifluoromethoxy)benzaldehyde is a chemical that is used as a reactant in organic chemistry. It can be used as a building block for the synthesis of complex compounds, or as an intermediate in the preparation of fine chemicals. 5-Bromo-2-(trifluoromethoxy)benzaldehyde is also useful in research and development. It has been used to synthesize pharmaceuticals, pesticides, and other organic compounds.</p>Formula:C8H4BrF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:269.02 g/molTetrabromophenyl-porphyrin
CAS:<p>Tetrabromophenyl-porphyrin (TBP) is a synthetic molecule that interacts with aldehydes in the presence of light. This interaction results in the formation of a phenyl radical and an excited state, which leads to the production of carbon dioxide and water. TBP is used as a catalyst for these reactions because it is more stable than other molecules that are typically used. The catalytic effect of TBP can be studied by means of spectroscopies and microscopy techniques. The crystal x-ray diffraction technique was used to analyze the molecular structure of TBP by determining the distances between atoms in its molecules. It was discovered that TBP has two phenyl groups and four bromine atoms per porphyrin ring. Diffraction techniques were also used to study how light interacts with TBP molecules, showing that they have strong optical properties when adsorbed on surfaces.</p>Formula:C44H26N4Br4Purity:Min. 95%Molecular weight:930.32 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/molTrimeperidine hydrochloride
CAS:Controlled Product<p>Trimeperidine hydrochloride is a postoperative analgesic that is used in the treatment of nerve pain and other conditions. Trimeperidine hydrochloride belongs to the group of active substances. It has been shown to be effective as an epidural anesthesia for patients undergoing surgery and has a clinical effect on the nervous system, including pain, nausea, vomiting, and muscle spasms. Trimeperidine hydrochloride works by inhibiting the central nervous system (CNS) enzyme coagulation factor XIIa. It also prevents excessive release of neurotransmitters from nerve cells.br>br></p>Formula:C17H26ClNO2Purity:Min. 95%Molecular weight:311.85 g/molPoly(tetrafluoroethylene-co-perfluoro(propylvinyl ether))
CAS:<p>Poly(tetrafluoroethylene-co-perfluoro(propylvinyl ether)) is a multilayer, unsaturated, vinylidene polymer. It has an impermeability that is similar to polytetrafluoroethylene (PTFE), but with improved mechanical properties. Poly(tetrafluoroethylene-co-perfluoro(propylvinyl ether)) can be used as a coating on surfaces that are exposed to chemical substances or in food packaging. This material is also used in the production of laminated products and copolymers.</p>Formula:C7F14OPurity:Min. 95%Color and Shape:PowderMolecular weight:366.05(S)-(-)-3-Chloro-1-phenyl-1-propanol
CAS:<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>Formula:C9H11ClOPurity:Min. 95%Molecular weight:170.64 g/mol3-Chloro-4-(3-fluorobenzyloxy)aniline
CAS:<p>3-Chloro-4-(3-fluorobenzyloxy)aniline is a potent inhibitor of the epidermal growth factor receptor (EGFR), which is a tyrosine kinase that plays an important role in the initiation and progression of cancer. The compound has been shown to inhibit the proliferation of human cancer cell lines, such as breast cancer and prostate cancer, by blocking EGFR signaling. 3-Chloro-4-(3-fluorobenzyloxy)aniline also inhibits the activity of other kinases, such as lapatinib and 2-amino-4-fluorobenzoic acid. This inhibition may be due to its ability to bind to the ATP binding site on these enzymes.</p>Formula:C13H11ClFNOPurity:Min. 95%Color and Shape:PowderMolecular weight:251.68 g/mol(D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/molCys-CD36 (139-155) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-CD36 (139-155) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H133N25O26SPurity:Min. 95%Molecular weight:1,977.21 g/molPAR-2 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H55N9O8Purity:Min. 95%Molecular weight:657.8 g/mol5-Amino-2-bromobenzonitrile
CAS:<p>Please enquire for more information about 5-Amino-2-bromobenzonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5BrN2Purity:95%NmrMolecular weight:197.03 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H72N14O8Purity:Min. 95%Molecular weight:1,081.27 g/mol(D-His2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/mol5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester
CAS:<p>Please enquire for more information about 5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7F3N2O2Purity:Min. 95%Molecular weight:208.14 g/molLys-Thymic Factor trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H68N14O17Purity:Min. 95%Molecular weight:1,005.04 g/molNeuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H135N25O24Purity:Min. 95%Molecular weight:1,915.16 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molNefazodone hydrochloride
CAS:Controlled Product<p>Antagonist of 5-HT2A serotonin, α2-adrenergic and dopamine (D2) receptors</p>Formula:C25H33Cl2N5O2Purity:Min. 95%Color and Shape:PowderMolecular weight:506.47 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/mol3-Chloro-N,N-dimethylpropan-1-amine
CAS:<p>3-Chloro-N,N-dimethylpropan-1-amine (3CMP) is a chemical that belongs to the group of organic solvents. It is soluble in water and has a low toxicity for mammals. 3CMP has been shown to have antimicrobial properties against typhimurium and other bacteria. 3CMP binds to the hydroxyl group of biomembranes and interferes with bacterial replication by inhibiting RNA synthesis. The mechanism of this inhibition may be due to the chloride ions that are released from the membrane or may be due to an increase in cell size, which can lead to hypertrophy. 3CMP binds to the chloride ion on bacterial membranes, which inhibits the synthesis of RNA by blocking its ability to bind with the ribosome. This leads to cell death by inhibiting protein synthesis and cell division.</p>Formula:C5H12ClNPurity:Min. 95%Molecular weight:121.61 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molAmyloid β-Protein (33-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (33-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H74N10O11SPurity:Min. 95%Molecular weight:915.15 g/molZ-2-Nal-chloromethylketone
CAS:<p>Please enquire for more information about Z-2-Nal-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H20ClNO3Purity:Min. 95%Molecular weight:381.85 g/mol
