Organic Halides

<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>

<p>H-Ala-Ala-Pro-Val-chloromethylketone is a hydrogen peroxide prodrug that is activated by the enzyme chloromethyl ketone. This drug has been shown to be active against schistosoma and pancreatic cancer cells, as well as in activating peroxide. HAPV may also have an effect on immunity and leukocytes, which could be due to its ability to sensitize these cells to damage caused by other agents, or through the hydrolytic enzymes it generates.</p>

<p>Please enquire for more information about 5-Bromo-2-fluoro-1,3-dimethylbenzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>8-Bromo-1-octanol is a fluorescent compound that has been shown to be resistant to cancer. It can be used as a probe for the detection of malonic acid in urine samples, which are an indicator of oxidative stress. 8-Bromo-1-octanol is stable in the presence of alcohol groups, and can be used to prepare samples for population growth studies. This chemical has also been used to study the growth of bacteria such as Pseudomonas aeruginosa and Escherichia coli. 8-Bromo-1-octanol emits light at a wavelength of 490 nm when exposed to ultraviolet radiation, which makes it useful for detecting chlorine atoms in water samples. The product research involving this chemical includes its effects on k562 cells and P. aeruginosa. Studies have also been done on its hydroxyl group and fatty acids and fatty acid esters, which are found in animal fat and vegetable oils.</p>

<p>Please enquire for more information about Methyl 5-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C5a Anaphylatoxin (37-53) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuronostatin-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Chloro-3-nitroaniline is an antibacterial agent that inhibits bacterial growth by binding to the enzyme topoisomerase II, which is essential for DNA replication. It has been shown to have a statistically significant inhibitory effect on the growth of Staphylococcus aureus. 4-Chloro-3-nitroaniline may also disrupt hemosiderosis and reduce iron levels in plasma samples from patients with hemosiderosis. The biological effects of this drug are not well understood.</p>

<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>

<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br&gt;<br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>

<p>Zinc trifluoromethanesulfonate is a catalyst that catalyses the reaction of amines with coumarin derivatives, producing an electrochemical impedance spectroscopy. It has been shown to have a redox potential that is higher than ferrocenecarboxylic acid. Zinc trifluoromethanesulfonate has been used in asymmetric synthesis, which involves substituting a hydrogen atom with another atom or group, and in salt metathesis, which is the process of forming new chemical compounds from reactants without using any energy. The zinc trifluoromethanesulfonate can also be activated by light or heat. This makes it possible for this compound to release the corrosive sulfur dioxide gas when heated to high temperatures, producing a synergic effect with other substances such as potassium permanganate (KMnO4).</p>

<p>Please enquire for more information about (D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diisopropylsilyl bis(trifluoromethanesulfonate) is a bifunctional reagent that can be used to prepare the trifluoromethanesulfonic acid. It reacts with an alcohol in the presence of base to generate an ester, and then hydrolyzes the ester in the presence of water to generate the desired acid. Diisopropylsilyl bis(trifluoromethanesulfonate) is pale yellow and soluble in argon, nitrogen, and solvents such as ethyl acetate.</p>

<p>Please enquire for more information about 1-Bromo-9-(4,4,5,5,5-pentafluoropentylthio)nonane including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-4-nitroimidazole is a chemical compound with the molecular formula C6H5BrNO2. It is an amide containing a nitroimidazole functional group. 2-Bromo-4-nitroimidazole can be used to synthesize pretomanid, which is an anti-tuberculosis drug. Pretomanid inhibits the growth of Mycobacterium tuberculosis by inhibiting protein synthesis and cell division. The active form of pretomanid has been shown to be hydrolyzed by hydrochloric acid and organic acids such as acetylcholinesterase and carboxypeptidase A. Pretomanid also binds to chloride ions, which may account for its ability to inhibit bacterial growth in acidic environments such as those found in the human stomach.</p>

<p>Please enquire for more information about Amyloid beta-Protein (20-29) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,5-Diiodo-4-methoxybenzhydrazide is a high quality chemical that is useful in the preparation of complex compounds. This compound has been shown to be an excellent reagent and useful intermediate for the synthesis of various fine chemicals. It has been used as a precursor for the production of the antiviral drug Tamiflu, among other pharmaceuticals. 3,5-Diiodo-4-methoxybenzhydrazide is also a versatile building block that can be used in research or as a reaction component in organic synthesis.</p>

<p>2-Chloro-N-[2-(diethylamino)ethyl]-4-quinolinecarboxamide is a carboxamide analog of dibucaine. It is synthesized from chloroacetyl chloride and isatin in the presence of sodium hydroxide. The synthesis has been scaled to an industrial level. 2-Chloro-N-[2-(diethylamino)ethyl]-4-quinolinecarboxamide has been shown to have analgesic properties, similar to those of dibucaine. Radiolysis of this compound gives a carboxylic acid and a heterocyclic ring product.</p>

<p>Butyl trifluoromethanesulfonate is an immunoregulatory agent that has been shown to have insulin-sensitizing and anti-inflammatory properties. It has been reported to cause a significant reduction in the concentration of glucose in the blood, which may be due to its ability to inhibit the synthesis of cholesterol esters. Butyl trifluoromethanesulfonate is also used as a solvent in detergent compositions, and as a reagent for synthesizing quinoline derivatives. This compound has been shown to increase the viscosity of oils and other organic solvents, making it useful for a wide range of industrial applications.</p>

<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>

<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,3-Difluoro-2-vinylbenzene is a hydroborating reagent that can be used to make alcohols from alkyl halides. It is also a potential sensor for the environment and has linearity in its response. 1,3-Difluoro-2-vinylbenzene may be an alternative to traditional hydroborating agents, such as diborane, which are toxic and expensive. This compound is sensitive to moisture and should be stored under nitrogen or argon gas.</p>

<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.</p>

<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Bromo-2-hydroxyphenyl)acetone is a chemical that is used as a building block in the synthesis of other compounds. It can be used as a reagent to produce 5-bromo-2,4-dihydroxyphenylacetic acid, which has been shown to have antiinflammatory and analgesic effects. 5-Bromo-2-hydroxyphenyl)acetone is also useful for the synthesis of polymers with applications in electronics and as an intermediate for the production of pharmaceuticals.</p>

<p>Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.</p>

<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>3,4-Dibromobenzoic acid ethyl ester is a high quality reagent that can be used as an intermediate for the synthesis of complex compounds. It is also useful as a building block for the synthesis of speciality chemicals and research chemicals. 3,4-Dibromobenzoic acid ethyl ester can be used in reactions such as Friedel-Crafts reactions, reducing reactions, and condensations. This chemical is a versatile building block that can be used to construct organic molecules with diverse structures. 3,4-Dibromobenzoic acid ethyl ester is a fine chemical with CAS number 60469-88-7.</p>

<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Leu-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,3-Difluoro-5-(trifluoromethyl)pyridine is a diluent that is used in organic synthesis. It is a nucleophilic and hydrogen fluoride (HF) activated fluoropyridine. This compound has a diameter of 190.7 pm and an anhydrous form. 2,3-Difluoro-5-(trifluoromethyl)pyridine can be prepared by condensing pyridine with fluorine gas in the presence of an activating agent such as HF or silver nitrate. This compound reacts when exposed to vapor or heat, releasing HF as a byproduct. The pyridine ring found in this compound contains six carbon atoms, two nitrogen atoms, and one oxygen atom.</p>

<p>5-Chlorouracil is a drug that is used to treat cancer. It has been shown to have biological properties, and its mechanism of action is not yet fully understood. 5-Chlorouracil can be synthesized in the laboratory by reacting sodium hydroxide with 5-chloro-2,4(1H,3H)-pyrimidinedione. In wastewater treatment plants, it reacts with organic matter in the water to form nontoxic products, such as carbon dioxide and urea. The reaction solution contains 5-chlorouracil, which undergoes tautomerization spontaneously or through the addition of base. This reaction is reversible, and both the erythro and threo forms are present in solution at equilibrium. The biological properties of 5-chlorouracil have been investigated using sublethal doses in experimental animals. In one study, 5-chlorouracil was found to inhibit xanthine oxidase activity in rats significantly more</p>

<p>1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd. is a cosmetically active organic solvent that is used as an ingredient in cosmetic products. It is also used as a raw material for the production of polymer films. 1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd. has been shown to be effective in preventing calcium carbonate from agglomerating and provides a constant viscosity in water. This product can also be used as a film-forming polymer with anti-fogging properties. The product also has nutritional supplement properties and can be found in dietary supplements such as fish oil capsules or vitamin E pills.</p>

<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Fluoropyridine-5-carboxaldehyde is a reactive chemical that can be used as an acceptor in organic synthesis. It has been shown to have antibacterial properties, and is also a synthon for the production of prosthetic groups. 2-Fluoropyridine-5-carboxaldehyde reacts with dopamine to form diphenyl ethers, which are used as labels for immunoassays. This chemical can be catalysed and has been shown to be resistant to catalysis. 2-Fluoropyridine-5-carboxaldehyde can also be used in the synthesis of cycloalkanes.</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Helical CRF (9-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Prifiniumbromide is an analog of GABA, which is a neurotransmitter found in the brain. It has been shown to be effective in patients with diabetic neuropathy and geriatric patients with constipation. Prifiniumbromide has also been used to treat inflammatory bowel disease and bladder disorders, such as detrusor muscle dysfunction. In addition, it has been shown to increase urinary output in patients with metabolic disorders.</p>

<p>1-(4,4'-Difluorobenzhydry)piperazine (1-DFBP) is a potential antitumor agent that has been shown to inhibit the growth of leukemia cells. It may be an inhibitor of apoptotic cell death, as it has been shown to induce hydrogen bond formation with coumarin derivatives. 1-DFBP has also been shown to have inhibitory activities against leukemia HL-60 cells, and is a competitive inhibitor of cinnarizine. The catalytic mechanism for 1-DFBP is not known, although kinetic data suggest that it involves hydrogen bonding and/or pi stacking interactions.</p>

<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>

<p>Please enquire for more information about Fibronectin Fragment (1376-1380) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Bromo-2-hydroxybenzaldehyde is an organic compound with a chemical formula of CHBrO. It is a white solid that is soluble in water, ethanol, and acetone. The synthesis of 5-bromo-2-hydroxybenzaldehyde has been achieved by the acylation reaction of benzaldehyde with bromide ion. The selectivity for this reaction can be increased by using sodium borohydride as a reducing agent instead of lithium aluminum hydride. This method can be applied to the synthesis of salmeterol, which is used as a medicine in the treatment of asthma.</p>

<p>2-Bromo-5-chlorobenzaldehyde is an industrial chemical that is used as a precursor for the production of other chemicals. It can be synthesized by reacting 3-chlorobenzaldehyde with sodium bromide in the presence of a catalyst. 2-Bromo-5-chlorobenzaldehyde has been shown to have high reactivity, and can be used as a catalyst to produce large amounts of organic compounds. This chemical can also be produced in large quantities by neutralizing alkalis with acid, which is an effective way to dispose of these hazardous substances.</p>

<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4'-Bromo-2'-fluoroacetophenone is a bifunctional reagent that reacts with nucleophiles to form conjugates. It is used in the preparation of fluorinated DNA and RNA, as well as in electron-transfer reactions. The selectivity of 4'-bromo-2'-fluoroacetophenone can be attributed to the presence of fluorine atoms on both ends of the molecule.</p>

<p>5-Bromo-2-hydroxybenzaldehyde (5BHB) is an organic compound that has been shown to have a coordination geometry of group p2. This compound binds to DNA and RNA, inhibiting the transcription process. 5BHB also has the ability to form a copper complex with malonic acid. This redox potential is reduced by one electron when copper is added in order to form the copper complex, which allows for the reactivity of 5BHB to be increased. 5BHB binds to nucleic acids through hydrogen bonding interactions with nitrogen atoms and lone pairs on oxygen atoms. The reaction mechanism for 5BHB involves intramolecular hydrogen transfer from one molecule of 5BHB to another, forming an intermediate that then reacts with nucleic acid.</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.</p>

<p>Rhodium(III) chloride hydrate is a catalyst that is used in the oxidation of aromatic hydrocarbons. It has been shown to have an acidic reaction with hydrochloric acid and is used in the oxidation of benzene, toluene, ethylbenzene, and xylene. Rhodium(III) chloride hydrate has also been shown to be a good catalyst for the production of polycyclic aromatic hydrocarbons from light emitting diodes. This product can be used as an oxidizing agent in organic synthesis reactions. The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Z)-1-(2,4-Dichlorophenyl)-2-(1H-imidazol-1-yl)ethanone oxime is an antifungal agent that inhibits the synthesis of ergosterol, a major constituent of fungal cell membranes. It has been shown to be active against a variety of fungi and yeasts. (Z)-1-(2,4-Dichlorophenyl)-2-(1H-imidazol-1-yl)ethanone oxime also has antimicrobial activity against bacteria such as Staphylococcus aureus and Pseudomonas aeruginosa.</p>

<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chlorothiazole is a solvent that is used in the chlorinating of acetylcholine. It has been shown to be carcinogenic in animals, but there is no evidence that it causes cancer in humans. 2-Chlorothiazole binds to the nicotinic acetylcholine receptor and blocks the neurotransmitter acetylcholine, which results in paralysis and death of insects. It has also been shown to have neonicotinoid properties. 2-Chlorothiazole is soluble in methanol and can be quantified using kinetic data or an analytical method involving human urine as a sample matrix. The reactivity of 2-chlorothiazole with hydrogen chloride yields chloromethyl ketone and chloride ions, which can be analyzed by gas chromatography/mass spectrometry (GC/MS). The chemical structure of 2-chlorothiazole consists of two chlorine atoms bonded to an amide group at one end and a single carbon at</p>

<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3’’’-Epi-Empagliflozin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(Bromomethyl)phenylacetic acid is a potent cancer drug that blocks the activity of hydrogen-bonding interactions. It inhibits the growth of prostate cancer cells, DU145 cells, and other cell lines. The drug has been shown to inhibit the activation of toll-like receptor 4 (TLR4) in primary blood cells from healthy donors. TLR4 is a protein found on the surface of immune cells that senses molecules from bacteria, fungi, parasites, and viruses. This protein plays an important role in triggering anti-inflammatory and pro-inflammatory responses to infection. The drug also inhibits platelet aggregation and lipoprotein lipase activity in vitro.</p>

<p>Please enquire for more information about RANTES (3-68) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-5-benzoylthiophene is a brominated hydrophobic compound. It has a catalytic activity and can be used as an antibacterial agent. The 9-oxime of 2-bromo-5-benzoylthiophene is more active than the free drug and is capable of inhibiting the growth of bacteria in vitro. This oxime also has a higher affinity for DNA gyrase and topoisomerase IV than other drugs in this class, which may be due to its hydrophobic nature or bromine substitution. Molecular modeling studies have shown that the chlorine atom in the 9-oxime plays an important role in stabilizing the complex formed with DNA gyrase or topoisomerase IV, which could explain its high activity against these enzymes.</p>

<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>

<p>Please enquire for more information about 1-(2-Fluorobenzyl)-1H-pyrazolo[3,4-b]pyridine-3-carboximidamide hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Cys(dodecyl)-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(2,4-Difluorophenyl)-1-(1H-1,2,4-triazol-1-yl)-3-(4H-1,2,4-triazol-4-yl)propan-2-ol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Amino-2-chloro-3-fluorobenzonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>R-(-)-3-Quinuclidinyl chloroformate is a chemical intermediate that is used as a reagent in organic synthesis. It reacts with amines to form quaternary ammonium salts, which are often used as reaction components in the production of pharmaceuticals. R-(-)-3-Quinuclidinyl chloroformate has been shown to be useful for the preparation of various heterocycles. This compound has been found to have several biological activities, including the ability to inhibit protein synthesis and induce apoptosis.</p>

<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>

<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>