
Organic Halides
In this category, you can find organic molecules containing one or more halogen atoms in their structure. These organic halides include brominated, iodinated, chlorinated, and cyclic halide compounds. Organic halides are widely used in organic synthesis, pharmaceuticals, agrochemicals, and materials science due to their reactivity and ability to undergo a variety of chemical transformations. At CymitQuimica, we offer a comprehensive selection of high-quality organic halides to support your research and industrial applications, ensuring reliable and effective performance in your synthetic and analytical projects.
Subcategories of "Organic Halides"
Found 20437 products of "Organic Halides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
5-Chlorouracil
CAS:<p>5-Chlorouracil is a drug that is used to treat cancer. It has been shown to have biological properties, and its mechanism of action is not yet fully understood. 5-Chlorouracil can be synthesized in the laboratory by reacting sodium hydroxide with 5-chloro-2,4(1H,3H)-pyrimidinedione. In wastewater treatment plants, it reacts with organic matter in the water to form nontoxic products, such as carbon dioxide and urea. The reaction solution contains 5-chlorouracil, which undergoes tautomerization spontaneously or through the addition of base. This reaction is reversible, and both the erythro and threo forms are present in solution at equilibrium. The biological properties of 5-chlorouracil have been investigated using sublethal doses in experimental animals. In one study, 5-chlorouracil was found to inhibit xanthine oxidase activity in rats significantly more</p>Formula:C4H3ClN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:146.53 g/molH-Ser(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ser(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Hel 13-5 trifluoroacetate salt
CAS:Controlled Product<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formula:C113H204N24O19Purity:Min. 95%Molecular weight:2,202.98 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/molNeuromedin U-8 (porcine) trifluoroacetate salt
CAS:<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>Formula:C54H78N16O10Purity:Min. 95%Molecular weight:1,111.3 g/molBoc-β-iodo-Ala-OMe
CAS:<p>Boc-beta-iodo-Ala-OMe is a hydrophobic reagent that can be used in peptide synthesis. It can be used in organic solvents, such as methyl ester, to synthesize homologues of amino acids and amino acid derivatives. Boc-beta-iodo-Ala-OMe is an electrophile that reacts with a nucleophile to produce the corresponding enantiomeric product. The hydrophobic nature of this reagent makes it useful for reactions involving solvents with low polarity, such as halides and alcohols.</p>Formula:C9H16INO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:329.13 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Formula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/mol(Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H287N55O57SPurity:Min. 95%Molecular weight:4,285.71 g/mol(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H43N5O8Purity:Min. 95%Molecular weight:637.72 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H83N17O11Purity:Min. 95%Molecular weight:1,062.27 g/molDefensin HNP-1 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.</p>Formula:C150H222N44O38S6Purity:Min. 95%Molecular weight:3,442.04 g/mol(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H60N10O8Purity:Min. 95%Molecular weight:796.96 g/molPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
CAS:<p>Pancreastatin is a cytosolic protein that inhibits the production of peptide hormones such as glucagon, insulin, and gastrin. It is used to treat bowel disease, including carcinoid syndrome and inflammatory bowel disease. Pancreastatin has been shown to inhibit the activity of cyclase enzymes that are responsible for the production of these hormones. Pancreatic beta-cells produce pancreatic polypeptide (PP), which is converted by pancreastatin into inactive PP2. Pancreatic alpha-cells produce somatostatin (SS), which is converted by pancreastatin into inactive SS2. Pancreatic delta cells produce pancreatic polypeptide (PP), which is not affected by pancreastatin. Pancreatic somatostatinomas secrete SS, which is not affected by pancreastatin.</p>Formula:C214H330N68O76SPurity:Min. 95%Molecular weight:5,103.39 g/molChloromethyl methyl carbonate
CAS:<p>Chloromethyl methyl carbonate (CMC) is an anti-influenza drug that inhibits the influenza virus's ability to infect cells by inhibiting cap-dependent endonuclease. It has been shown to be effective against influenza A and B viruses. CMC is a nonaqueous solvent that reacts with halides, such as hydrogen fluoride, magnesium salt, and chloroform, leading to the formation of nitrogen atoms. The nitrogen atoms are then used in a reaction with carbocycles to form molecules. CMC is also shown to be an important precursor for the synthesis of fluorinated pharmaceuticals.</p>Formula:C3H5ClO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:124.52 g/molN-Allyl-n-(2-chloro-5-cyanophenyl)acetamide
CAS:<p>N-Allyl-n-(2-chloro-5-cyanophenyl)acetamide is a fine chemical that is used as a building block in the synthesis of other compounds. It is also used in research and as a reagent or speciality chemical. N-Allyl-n-(2-chloro-5-cyanophenyl)acetamide has been shown to be an excellent intermediate for complex organic reactions, such as coupling reactions with amines, alcohols, and thiols. In addition, this compound can be used to form new scaffolds for biological studies.</p>Formula:C12H11ClN2OPurity:Min. 95%Color and Shape:PowderMolecular weight:234.68 g/molZ-Arg-AMC hydrochloride salt
CAS:<p>Z-Arg-AMC hydrochloride salt is a proteolytic agent that inhibits serine proteases. It can be used to study the biological function of proteases and as a tool in the kinetic analysis of protease activity. Z-Arg-AMC hydrochloride salt has been shown to inhibit trypsin, chymotrypsin, and elastase enzymes at nanomolar concentrations. This compound also inhibits human pathogens such as enterovirus 71 and herpes simplex virus type 1, which are associated with severe disease symptoms. The structural analysis of Z-Arg-AMC hydrochloride salt has shown it to be a racemic mixture of L-Arginine and D-Arginine with an average molecular weight of 313.5 Da.</p>Formula:C24H27N5O5Purity:Min. 95%Molecular weight:465.5 g/mol3-Bromo-2-methyl-5-nitropyridine
CAS:<p>Please enquire for more information about 3-Bromo-2-methyl-5-nitropyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H5BrN2O2Purity:Min. 95%Molecular weight:217.02 g/mol(1S,4S)-2-Oxa-5-azabicyclo[2.2.1]heptane hydrochloride
CAS:<p>Please enquire for more information about (1S,4S)-2-Oxa-5-azabicyclo[2.2.1]heptane hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H10ClNOPurity:Min. 95%Molecular weight:135.59 g/mol1,3-Difluoro-2-vinylbenzene
CAS:<p>1,3-Difluoro-2-vinylbenzene is a hydroborating reagent that can be used to make alcohols from alkyl halides. It is also a potential sensor for the environment and has linearity in its response. 1,3-Difluoro-2-vinylbenzene may be an alternative to traditional hydroborating agents, such as diborane, which are toxic and expensive. This compound is sensitive to moisture and should be stored under nitrogen or argon gas.</p>Formula:C8H6F2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:140.13 g/molN-Me-Abz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H116N26O18Purity:Min. 95%Molecular weight:1,609.83 g/molNe-Z-L-lysine tert-butyl ester hydrochloride
CAS:<p>Ne-Z-L-lysine tert-butyl ester hydrochloride is a multidrug that inhibits the activity of the P-glycoprotein (Pgp) transporter. This drug is an antigen that can be used as a marker for cytostatic drugs, and it can be used in radionuclide localization. Ne-Z-L-lysine tert-butyl ester hydrochloride has been shown to have cytostatic effects on malignant cells, but its cytotoxicity varies depending on the type of cancer cell. Ne-Z-L-lysine tert-butyl ester hydrochloride has also been shown to be degradable and to possess conjugates with antibodies, which makes it useful for treating some types of cancers. Ne-Z-L-lysine tert-butyl ester hydrochloride is not active against resistant cells such as those expressing Pgp or MRP1 proteins.</p>Formula:C18H28N2O4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:372.89 g/molAbz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N17O13Purity:Min. 95%Molecular weight:1,124.25 g/molBNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/mol2-Chloro-4-iodopyridine
CAS:<p>2-Chloro-4-iodopyridine is an antibacterial agent that inhibits bacterial growth by interfering with the synthesis of folic acid. It has been shown to be effective against Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa. 2-Chloro-4-iodopyridine is a ligand that binds to metal ions such as copper and silver. The transfer of electrons from the metal ion to the ligand facilitates the cross-coupling reaction in organic synthesis. Cross-coupling reactions are also used in devices such as solar cells and hydrogen fuel cells.<br>2-Chloro-4-iodopyridine can also be used for photophysical experiments with single crystal x-ray diffraction studies.</p>Formula:C5H3ClINPurity:Min. 95%Color and Shape:White PowderMolecular weight:239.44 g/molMeOSuc-Ala-Ala-Pro-Val-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Val-chloromethylketone is a serine protease inhibitor that has been shown to be effective against influenza virus and HIV. It was found to be active against a number of serine proteases, such as trypsin, chymotrypsin, and elastase. MeOSuc-Ala-Ala-Pro-Val-chloromethylketone also has chemotactic activity in thp1 cells and lung fibroblasts. It is activated by the addition of water and has been shown to inhibit the growth of soybean trypsin. However, it does not have any effect on human trypsin.</p>Formula:C22H35ClN4O7Purity:Min. 95%Molecular weight:502.99 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/mol3-Fluorophenyl boronic acid
CAS:<p>Please enquire for more information about 3-Fluorophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6BFO2Purity:Min. 95%Color and Shape:PowderMolecular weight:139.92 g/mol(3-Bromopropyl)trimethoxysilane
CAS:<p>3-Bromopropyltrimethoxysilane is a divalent hydrocarbon that has been used as a model compound for the study of detection methods. It has been shown to have biocompatible properties and can be used as an immobilization template molecule. 3-Bromopropyltrimethoxysilane also reacts with pyridinium ions to form complexes that are highly stable. The stability of these complexes can be attributed to the functional groups on the pyridine ring, which are more susceptible to hydrolysis than those on the silica surface. 3-Bromopropyltrimethoxysilane is a substrate for nitrate reductase enzymes, resulting in inhibition of growth at concentrations low enough not to cause cytotoxicity.</p>Formula:C6H15BrO3SiPurity:Min. 95%Molecular weight:243.17 g/molCRAMP (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/molAngiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans</p>Formula:C50H71N13O12·xC2HF3O2Purity:Min. 95%Molecular weight:1,046.18 g/molPhenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about Phenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C170H280ClN53O41Purity:Min. 95%Molecular weight:3,757.83 g/molAmyloid β/A4 Protein Precursor770 (403-407) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (403-407) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H47N11O9SPurity:Min. 95%Molecular weight:677.78 g/molH-Arg-4MbetaNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Arg-4MbetaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O2·xHClPurity:Min. 95%Molecular weight:365.86 g/mol4-Fluoro-2-methoxyaniline
CAS:<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/molTris(1-chloro-2-propyl) phosphate - mixture of isomers
CAS:<p>Tris(1-chloro-2-propyl) phosphate is a synthetic compound that belongs to the class of diphenyl ethers. It is used as an intermediate in the production of other chemicals, such as plastics and pesticides. Tris(1-chloro-2-propyl) phosphate has been shown to be toxic to cells by inhibiting mitochondrial membrane potential and interfering with cellular metabolism. This chemical can cause severe health effects, such as liver damage and death, at high doses. Tris(1-chloro-2-propyl) phosphate can also be detected in human serum and urine samples with high sensitivity.</p>Formula:C9H18Cl3O4PPurity:Min. 95%Molecular weight:327.57 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molα-Helical CRF (12-41) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Helical CRF (12-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H251N43O47S2Purity:Min. 95%Molecular weight:3,497.01 g/mol3-Bromobenzonitrile
CAS:<p>3-Bromobenzonitrile is an organic compound that has a hydroxyl group and a bromine atom. It is an organic chemical compound that can be synthesized by the reaction of benzene with nitric acid and azide. 3-Bromobenzonitrile has been studied for its biological properties. It also reacts with amines, quinoline derivatives, and other reactive molecules to form new compounds. 3-Bromobenzonitrile has been shown to have transport properties, which can be determined using FT-IR spectroscopy techniques.</p>Formula:C7H4BrNPurity:Min. 95%Color and Shape:PowderMolecular weight:182.02 g/molα-Conotoxin MI trifluoroacetate salt
CAS:Controlled Product<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>Formula:C58H88N22O17S4Purity:Min. 95%Molecular weight:1,493.72 g/mol2-(5-Bromo-2-pyridylazo)-5-(diethylamino)phenol
CAS:<p>2-(5-Bromo-2-pyridylazo)-5-(diethylamino)phenol is a chemical that is used for the detection of hydrochloric acid in water vapor. It reacts with zirconium oxide, which generates a red fluorescing complex. The reaction can be detected by using a fluorescence spectrometer with a test sample. 2-(5-Bromo-2-pyridylazo)-5-(diethylamino)phenol is also used to detect the presence of nitrogen atoms and sodium citrate in samples by reacting with them. This chemical reacts with an acid complex to form stable complexes. The analytical method is based on measuring the redox potential of this reaction. The flow system of this technique allows for dehydration of dehydroascorbic acid (DHA).</p>Formula:C15H17BrN4OPurity:Min. 95%Color and Shape:PowderMolecular weight:349.23 g/mol4-Chloro-3-nitrobenzenesulfonamide
CAS:<p>4-Chloro-3-nitrobenzenesulfonamide is a fluorogenic probe that can be used in the diagnosis of cancer. It inhibits the activity of MCL-1, which is an antiapoptotic protein. The skeleton of 4-Chloro-3-nitrobenzenesulfonamide has been shown to have carbonic and fluorescence properties. This chemical compound is also metabolized by azobenzene to form a fluorescent derivative that can be used for optical imaging in vivo.</p>Formula:C6H5ClN2O4SPurity:Min. 95%Molecular weight:236.63 g/mol3-Fluoro-2-nitrobenzoic acid
CAS:<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molDiphenyliodonium chloride
CAS:<p>Diphenyliodonium chloride is a synthetic chemical that binds to DNA and inhibits the synthesis of proteins. It also has been shown to inhibit the growth of Gram-positive bacteria, including Methicillin-resistant Staphylococcus aureus (MRSA) and Streptococcus pneumoniae, but not Gram-negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. Diphenyliodonium chloride is used in a variety of ways, including as an antimicrobial agent for the prevention of microbial contamination in pharmaceuticals and cosmetics.</p>Formula:C12H10ClIPurity:Min. 95%Color and Shape:White PowderMolecular weight:316.56 g/molDynorphin A (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H127N25O14Purity:Min. 95%Molecular weight:1,602.97 g/mol3,4,5-Trichlorobenzoic acid
CAS:<p>Trichlorobenzoic acid is a chemical compound that is found in plants, such as Trifolium pratense L. and other legumes. It has been shown to inhibit the growth of bacteria by competitive inhibition of the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxyribonucleotides. This prevents the production of RNA, which is necessary for protein synthesis and cell division. Inhibition of this enzyme can be achieved by either conjugating trichlorobenzoic acid with a sugar or using ion-exchange resins to remove it from water. The concentration required for this type of inhibition varies depending on the type of organism, but generally ranges between 5-10 ppm.END></p>Purity:Min. 95%Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molSperm Peptide P10G trifluoroacetate salt
CAS:<p>Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H58N10O13Purity:Min. 95%Molecular weight:838.91 g/mol4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester
CAS:<p>Please enquire for more information about 4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H23ClN2O3Purity:Min. 95%Molecular weight:374.86 g/molH-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molH-Gly-Pro-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.</p>Formula:C12H19N3O4Purity:Min. 95%Molecular weight:269.3 g/molH-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H71N11O15S2Purity:Min. 95%Molecular weight:1,226.38 g/molHCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H116N20O17Purity:Min. 95%Molecular weight:1,425.72 g/molH-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H98N16O15SPurity:Min. 95%Molecular weight:1,507.76 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/molL-Cystine dihydrochloride
CAS:<p>L-Cystine dihydrochloride is a chemical compound that is used as an amino acid. It has biological properties that are due to its ability to inhibit pancreatic lipase and l-threonine. L-Cystine dihydrochloride has been shown to have anti-infectious effects against a number of bacterial and viral diseases, including HIV, herpes simplex virus, and influenza. L-Cystine dihydrochloride is also used in cell culture experiments because it can be used to break disulfide bonds in proteins.</p>Formula:C6H14Cl2N2O4S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:313.22 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/mol4-Isopropylphenylhydrazine hydrochloride
CAS:<p>4-Isopropylphenylhydrazine, hydrochloride (IPH) is a chemical compound that has been shown to induce rearrangements in the indolenines. IPH can also be used as a nucleophile. IPH is regioselective and stereoselective for the indole ring system. It has shown to react with nucleophiles such as alcohols, amines, and thiols.</p>Formula:C9H14N2•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:186.68 g/mol2-Aminoindole hydrochloride
CAS:<p>2-Aminoindole hydrochloride is a heterocyclic amine that is formed by the reaction of benzene and an aminoindole. It is a difunctional compound that can react with alcohols to form amides, carbonyl groups to form ketones, or carbamate groups to form ureas. This compound has been shown to act as an activated aromatic amine that reacts with oxygen in the atmosphere to form a variety of products, including chlorinated aromatic amines. 2-Aminoindole hydrochloride has been shown to have carcinogenic effects in rats when administered orally at high doses.</p>Formula:C8H9ClN2Purity:Min. 95%Color and Shape:Slightly Yellow PowderMolecular weight:168.62 g/mol2-Chloromethyl-3,5-dimethylpyridin-4-ol
CAS:<p>Please enquire for more information about 2-Chloromethyl-3,5-dimethylpyridin-4-ol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H10ClNOPurity:Min. 95%Molecular weight:171.62 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/mol4,6-Dichloro-pyridin-3-ylamine
CAS:<p>Please enquire for more information about 4,6-Dichloro-pyridin-3-ylamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H4Cl2N2Purity:Min. 95%Color and Shape:PowderMolecular weight:163 g/molLHRH II trifluoroacetate salt
CAS:<p>LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.</p>Formula:C60H69N17O13Purity:Min. 95%Molecular weight:1,236.3 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molBoc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt
CAS:<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>Formula:C34H52N8O10Purity:Min. 95%Molecular weight:732.82 g/molBis(N,N-dimethylacetamide) hydrogen dibromobromate
CAS:<p>Bis(N,N-dimethylacetamide) hydrogen dibromobromate (DMBB) is a chemical with a variety of uses in research and industrial chemistry. It is an intermediate for the synthesis of other chemicals and can be used as a reagent in organic synthesis. DMBB is also known to be useful as a building block for the synthesis of complex compounds. The CAS number for DMBB is 75381-80-5.</p>Formula:C4H9NO·HBr4Purity:Min. 95%Color and Shape:PowderMolecular weight:494.86 g/mol4-Fluoromethyl-α-methylbenzyl alcohol
CAS:<p>4-Fluoromethyl-alpha-methylbenzyl alcohol is a nonclassical molecule that has been synthesized. This molecule has been modeled computationally and the results indicate that it exhibits a planar geometry with a diastereomeric ratio of 1:1. The theoretical calculations show that the reaction of 4-fluoromethyl-alpha-methylbenzyl alcohol with water is exothermic, which would result in the formation of an intermediate hydroxide ion. Kinetic studies have shown that this molecule can undergo transfer reactions and dehydrogenation reactions, both of which are possible mechanisms for its reactivity.</p>Formula:C8H9FOPurity:Min. 95%Molecular weight:140.15 g/molH-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%4-Fluorophenethyl bromide
CAS:<p>4-Fluorophenethyl bromide is an antagonist that blocks the binding of agonists to β-adrenoceptors. It has been shown to be a potent and selective antagonist of the β-adrenoceptor, with little effect on other receptors. This compound has been synthesized by reacting 4-fluorobenzeneethanol with ethyl bromoacetate, leading to a product that has a high affinity for β-adrenoceptors. In animal studies, 4-fluorophenethyl bromide was found to be selective for the trachea, inhibiting airway constriction responses in rats. This compound also had high potency, as it was able to produce an increase in heart rate in animals at low dosages.</p>Formula:C8H8BrFPurity:Min. 95%Molecular weight:203.05 g/molHomo-L-tyrosine hydrobromide
CAS:<p>Homo-L-tyrosine hydrobromide (HLTB) is a prodrug that is converted to L-3,4-dihydroxyphenylalanine (L-dopa) in vivo. It is used as an immunomodulator by stimulating the immune system and reducing inflammation. HLTB has been shown to have anti-inflammatory effects on the production of cytokines and chemokines, which are important for tumor growth and metastasis. HLTB is also known to inhibit tyrosine kinase, which plays a role in the development of some cancers.</p>Formula:C10H14BrNO3Purity:Min. 95%Molecular weight:276.13 g/mol1-Dodecylpyridinium chloride
CAS:<p>1-Dodecylpyridinium Chloride is a quaternary ammonium salt that is used as an antimicrobial agent in a variety of products, such as pharmaceuticals, cosmetics, and household products. It has been shown to be toxic to humans at doses above 0.5 mg/kg. At sublethal doses, 1-dodecylpyridinium chloride inhibits the growth of bacteria by binding to the cationic sites on their cell surfaces and preventing them from attaching to other cells or molecules in their environment. 1-Dodecylpyridinium chloride also binds to the enzyme p-nitrophenyl phosphate reductase, which is required for bacterial growth. This inhibition leads to cell death by preventing ATP production and protein synthesis.</p>Formula:C17H30N•ClPurity:Min. 95%Molecular weight:283.88 g/mol(Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
<p>Please enquire for more information about (Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H205N39O29SPurity:Min. 95%Molecular weight:2,846.36 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/molMet-RANTES (human) trifluoroacetate salt
<p>Please enquire for more information about Met-RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C355H543N97O101S6Purity:Min. 95%Molecular weight:7,978.1 g/mol2-Bromo-5-methylpyrimidine
CAS:<p>Please enquire for more information about 2-Bromo-5-methylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H5BrN2Purity:95%NmrMolecular weight:173.01 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molH-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H61N9O7S2·C2HF3O2Purity:Min. 95%Molecular weight:970.13 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H79N13O12S2Purity:Min. 95%Molecular weight:1,034.3 g/mol4-Bromo-1-methyl-1H-imidazole
CAS:<p>4-Bromo-1-methyl-1H-imidazole is an organic compound that belongs to the group of imidazoles. It is a chiral molecule with two stereoisomers, 4-bromo-1H-imidazole and 1H-imidazole. This compound can be synthesized by reacting ethyl formate with α-amino acid and chlorides in the presence of magnesium, followed by reduction with lithium aluminum hydride. The yield of this reaction is low, so it is not used in industrial processes. The imidazoles are important for their pharmacological activity as they are a class of drugs such as nitrofurantoin or griseofulvin. The dinitrate derivatives are also important for their metallation reactions and use in organic synthesis.</p>Formula:C4H5BrN2Purity:Min. 95%Molecular weight:161 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H70N12O20Purity:Min. 95%Molecular weight:1,195.19 g/molDnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt
<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H64N14O12SPurity:Min. 95%Molecular weight:965.09 g/molBuccalin trifluoroacetate salt
CAS:<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>Formula:C45H72N12O15SPurity:Min. 95%Molecular weight:1,053.19 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/mol5-Bromo-2-fluorobenzoic acid
CAS:<p>5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.</p>Formula:C7H4BrFO2Purity:Min. 95%Color and Shape:PowderMolecular weight:219.01 g/molAmyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H141N21O30SPurity:Min. 95%Molecular weight:1,993.24 g/mol4-Methoxy-3-(trifluoromethyl)benzoic acid
CAS:<p>4-Methoxy-3-(trifluoromethyl)benzoic acid is a useful scaffold that can be used as a building block for the synthesis of complex compounds. It has been shown to react with various reagents and is a versatile building block that can be used in organic synthesis. 4-Methoxy-3-(trifluoromethyl)benzoic acid is a high quality chemical and has been classified as speciality chemicals. This product is also known by the CAS number 213598-09-5.</p>Formula:C9H7F3O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:220.15 g/molH-Lys(Boc)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Tri-tert-butylphosphine tetrafluoroborate
CAS:<p>Tri-tert-butylphosphine tetrafluoroborate (TBPB) is a compound that inhibits tumor growth by inhibiting the activation of allyl carbonates. TBPB has been shown to inhibit tumor growth in vivo and to have an inhibitory effect on the growth of cancer cells in vitro. This drug has been shown to be effective against multiple types of cancer, including breast, prostate, leukemia, and lymphomas. TBPB also inhibits the activity of protein kinase C (PKC), which may play a role in tumorigenesis. It is believed that this drug works by binding to PKC and preventing its activation.</p>Formula:C12H28BF4PPurity:Min. 95%Color and Shape:White PowderMolecular weight:290.13 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/mol4-Chloro-6,7-dimethoxyquinoline
CAS:<p>4-Chloro-6,7-dimethoxyquinoline (4C6DMQ) is a potent inhibitor of the growth of prostate cancer cells. 4C6DMQ is an analog of chloropropyl chloride, which inhibits the growth of epidermal growth factor receptor (EGFR). The binding site for 4C6DMQ on EGFR is the same as that for chloropropyl chloride. 4C6DMQ inhibits EGFR by preventing the activation of downstream signaling cascades, leading to a decrease in cell proliferation and tumor size. The IC50 values for 4C6DMQ are approximately 10 times higher than those for chloropropyl chloride. This drug has been shown to be more potent than other inhibitors of EGFR such as erlotinib and gefitinib.</p>Formula:C11H10ClNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:223.66 g/molEthyl 4-bromoacetoacetate
CAS:<p>Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.</p>Formula:C6H9BrO3Purity:90%NmrMolecular weight:209.04 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/mol2,4-Dichlorobenzaldehyde
CAS:<p>2,4-Dichlorobenzaldehyde is a compound that is a member of the class of phenylpropanoids. It has been shown to react with curcumin analogues to form 1,3-dichloro-2,4-bis(chloromethyl)benzene and 1,3-dichloro-2,4-(1′,2′-dichloroethoxy)benzene. These products have been found to have high values for fluorescence analysis. This molecule also has physiological effects as a growth regulator and antimicrobial agent. 2,4-Dichlorobenzaldehyde has been used in analytical methods such as dihedral angle determination and synthetic processes like the synthesis of benzaldehydes.</p>Formula:C7H4Cl2OPurity:Min. 95%Color and Shape:PowderMolecular weight:175.01 g/mol3-Trifluoromethyl phenylhydrazine hydrochloride
CAS:<p>3-Trifluoromethyl phenylhydrazine HCl is a fine chemical that can be used as a versatile building block in the synthesis of complex compounds. It has been shown to be a useful intermediate for the preparation of research chemicals, reaction components and speciality chemicals. 3-Trifluoromethyl phenylhydrazine HCl belongs to CAS No. 3107-33-3 and can be used as a reagent in organic synthesis. The compound is high quality with a purity of over 99%.</p>Formula:C7H8ClF3N2Purity:Min. 95%Color and Shape:PowderMolecular weight:212.6 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/mol4-Nitro-D-phenylalanine methyl ester hydrochloride
CAS:<p>Please enquire for more information about 4-Nitro-D-phenylalanine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O4·HClPurity:Min. 95%Molecular weight:262.69 g/mol1-Hydroxy-6-(Trifluoromethyl)Benzotriazole
CAS:<p>1-Hydroxy-6-(trifluoromethyl)benzotriazole is a chemical compound that is used as a reagent and an additive in organic synthesis. It has been shown to react with the 7-aminocephalosporanic acid to form a reactive molecule, which is then acylated with various amines. The reaction time can be modified by adding certain additives, such as chloride or uridine. 1-Hydroxy-6-(trifluoromethyl)benzotriazole is also a solid phase synthesis, which means it reacts with other molecules during the synthesis process to form new substances. It also has acidic properties, and can act as a nucleophile in the presence of aminocephalosporanic acid. The structural formula for this chemical is shown below:</p>Formula:C7H4F3N3OPurity:Min. 95%Molecular weight:203.12 g/molAPL1b25 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H166N28O35SPurity:Min. 95%Molecular weight:2,328.6 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H38N6O5Purity:Min. 95%Molecular weight:526.63 g/molPerfluoro-N-(4-methylcyclohexyl)piperidine
CAS:Controlled Product<p>Perfluoro-N-(4-methylcyclohexyl)piperidine (4-FPP) is a fluorine compound that has been shown to inhibit the enzymatic activity of tyrosine kinases. It is a potent inhibitor of both human and murine tyrosine kinases, but it does not bind to bacterial tyrosine kinase domains. 4-FPP has been used in clinical studies as an anti-cancer drug, although it's clinical relevance remains unclear. It has also been shown to be effective against the influenza virus by inhibiting the synthesis of viral proteins that are involved in replication. The chemical structure of 4-FPP contains a carbonyl group that can react with other compounds through a photochemical process. This reaction is thought to result in the development of new drugs with similar biochemical properties to 4-FPP.</p>Formula:C12F23NPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:595.1 g/mol3-Iodo-1H-pyrrolo[2,3-b]pyridine
CAS:<p>3-Iodo-1H-pyrrolo[2,3-b]pyridine (3IOP) is a molecule that has been shown to be cytotoxic against human ovarian carcinoma cells. It induces significant cytotoxicity in cancer cell lines and inhibits the proliferation of lung fibroblasts. 3IOP has been shown to activate cellular signaling pathways and cause multinuclear DNA damage.</p>Formula:C7H5IN2Purity:Min. 95%Color and Shape:PowderMolecular weight:244.03 g/molLuteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt
CAS:<p>Luteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt is a potent antagonist of the luteinizing hormone-releasing hormone (LHRH) receptor. It is used specifically to treat platinum-resistant ovarian cancer, where it has been shown to be effective in reducing tumor size and volume. This drug has minimal toxicity and can be administered by injection or as a microcapsule. LHRH Antagonist trifluoroacetate salt is an analog of LHRH that has been modified so that it cannot cross the blood-brain barrier. It also binds to epidermal growth factor receptors, which are involved in cell proliferation, differentiation, and survival. Symptoms of overdose may include nausea, vomiting, headache, dizziness, seizures, and coma.</p>Formula:C48H59ClN12O8Purity:Min. 95%Molecular weight:967.51 g/mol5'-Fluoro-2'-hydroxyacetophenone
CAS:<p>5'-Fluoro-2'-hydroxyacetophenone is a synthetic compound that has been shown to inhibit the growth of human pathogens. It is an antimicrobial agent that can be used as an alternative to antibiotics for the treatment of bacterial infections. 5'-Fluoro-2'-hydroxyacetophenone was synthesized by means of an asymmetric synthesis from 5-fluoro-2-methoxybenzaldehyde, which had been obtained through a chemical study. The functional group that this compound belongs to is amide and it has acidic, sulphonate, and vibrational properties. Hydrochloric acid can demethylate this compound to produce 2-hydroxyacetophenone, which can be converted into 2-methylpropionaldehyde by methylation.</p>Formula:C8H7FO2Purity:Min. 95%Molecular weight:154.14 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/molEthyl malonyl chloride
CAS:<p>Ethyl malonyl chloride is a compound that belongs to the class of acylating agents. It reacts with the carbonyl group of an organic acid, such as malonic acid, to form an ester. This reaction is catalyzed by a nucleophile such as water or alcohols. Ethyl malonyl chloride has been shown to have anticancer activity and can inhibit protein synthesis in muscle cells by blocking receptor activity and growth factor signaling pathways.</p>Formula:C5H7ClO3Purity:90%MinMolecular weight:150.56 g/mol2-Bromo-5-hydroxy-4-methoxybenzaldehyde
CAS:<p>2-Bromo-5-hydroxy-4-methoxybenzaldehyde is a death pathway inhibitor that has been shown to have radiosensitizing effects in vitro. It has also been found to inhibit the expression of matrix metalloproteinase (MMP) in human glioma cells and in a rat model of cerebral ischemia. This compound may be used as a potential chemotherapeutic agent for the treatment of cancer. 2-Bromo-5-hydroxy-4-methoxybenzaldehyde inhibits cell proliferation by inducing apoptosis, or programmed cell death, which may be due to its ability to suppress MMP activity.</p>Formula:C8H7BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:231.04 g/mol(3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19F2NO4Purity:Min. 95%Molecular weight:315.31 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/mol(Dibromomethyl)benzene
CAS:<p>Dibromomethylbenzene is a reactive, non-metallic chemical compound with the formula CHBr2. It is a colorless liquid that is soluble in water and has a strong odor. Dibromomethylbenzene can be used to treat wastewater by removing metals, such as iron and copper, that are not removed by conventional methods. This compound also has been shown to inhibit the growth of infectious bacteria, such as Salmonella enterica and Escherichia coli. Dibromomethylbenzene reacts with metal hydroxides to produce volatile bromide ions, which react with the carbohydrate to form cyclic peptides. These reactions are catalyzed by solid catalysts like activated carbon or alumina.</p>Formula:C7H6Br2Purity:95%MinMolecular weight:249.93 g/molApelin-36 (1-16) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Apelin-36 (1-16) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H117N27O20Purity:Min. 95%Molecular weight:1,704.89 g/molTetrabromophenol blue sodium salt
CAS:<p>Tetrabromophenol blue sodium salt is a dye that is used as an additive in the production of vinyl alcohol polymer films. Tetrabromophenol blue sodium salt can be used to measure albumin concentration and postexposure by adding phenyl groups to the molecule. The color of tetrabromophenol blue sodium salt changes upon exposure to radiation, which makes it useful for diagnostic purposes. It also has a hydrocarbon group that transforms into an insoluble form when exposed to evaporation, making it useful for titration methods. Tetrabromophenol blue sodium salt is relatively stable and labile in nature, making it susceptible to techniques such as pyrolysis, oxidation, or reduction.</p>Formula:C19H5Br8NaO5SPurity:Min. 95%Molecular weight:1,007.53 g/molent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt
CAS:<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H119N15O13Purity:Min. 95%Molecular weight:1,486.88 g/mol(Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O7Purity:Min. 95%Molecular weight:651.71 g/mol(±)-DOI Hydrochloride
CAS:Controlled Product<p>(±)-DoiHydrochloride is a serotonergic drug that belongs to the group of serotonin reuptake inhibitors. It affects the serotonergic system by inhibiting serotonin reuptake, which leads to increased synaptic concentrations of serotonin. This in turn activates signal pathways and increases levels of dopamine, norepinephrine, and epinephrine. (±)-DoiHydrochloride has antioxidative properties and can be used for the treatment of chronic schizophrenia. It was shown to be effective in patients with atrial fibrillation who were not responding well to other treatments.</p>Formula:C11H16INO2•HClPurity:Min. 95%Molecular weight:357.62 g/molNeuropeptide VF (56-92) (human) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H304N52O51S2Purity:Min. 95%Molecular weight:4,256.95 g/molγ3-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H188N44O37SPurity:Min. 95%Molecular weight:2,943.18 g/mol3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole
CAS:<p>Please enquire for more information about 3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H9F3N2Purity:Min. 95%Molecular weight:226.2 g/molMethyl 6-chloronicotinate
CAS:<p>Methyl 6-chloronicotinate is a quinoline derivative that has been shown to have cytotoxic effects. This compound inhibits the DNA repair protein O6-alkylguanine-DNA alkyltransferase (O6-AGAT) and induces apoptosis by binding to the cation channel and inhibiting the influx of calcium ions, which leads to an increase in intracellular calcium levels. Methyl 6-chloronicotinate also inhibits cancer cell proliferation through its interaction with the voltage-gated sodium channels and potassium channels, which leads to cell death. The molecular modeling study revealed that methyl 6-chloronicotinate binds to a deep hydrophobic pocket on the surface of hct116 cells, indicating that this drug may be a potential anticancer agent.</p>Formula:C7H6ClNO2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:171.58 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C150H246N44O38Purity:Min. 95%Molecular weight:3,273.83 g/molH-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H149N31O26SPurity:Min. 95%Molecular weight:2,017.32 g/molpTH-Related Protein (1-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>Formula:C180H288N58O47Purity:Min. 95%Molecular weight:4,016.58 g/mol4-Chloro-Nicotinic acid ethyl ester hydrochloride
CAS:<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>Formula:C8H8ClNO2·HClPurity:Min. 95%Molecular weight:222.07 g/mol(Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C169H279N53O51S2Purity:Min. 95%Molecular weight:3,933.48 g/molH-Gly-Arg-bNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Gly-Arg-bNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H24N6O2Purity:Min. 95%Molecular weight:356.42 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molAQEE-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C157H252N48O56Purity:Min. 95%Molecular weight:3,707.97 g/mol3-Amino-5-chloropyrazine-2-carbonitrile
CAS:<p>Please enquire for more information about 3-Amino-5-chloropyrazine-2-carbonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H3ClN4Purity:Min. 95%Molecular weight:154.56 g/molBoc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS:<p>Please enquire for more information about Boc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N4O4Purity:Min. 95%Molecular weight:344.45 g/molPropamocarbHydrochloride
CAS:<p>Propamocarb hydrochloride is a crystalline polymorph that has been found to be active against the bacterial strain. The mechanism of action is not yet known, but it may be due to inhibition of the enzyme carboxypeptidase A and/or an unknown biological function. Propamocarb hydrochloride has shown no significant toxicity in animal studies up to a dose of 2000 mg/kg. This compound has been studied as a potential treatment for tissue damage caused by inflammation and disease. In vitro experiments have shown that propamocarb hydrochloride is effective at inhibiting the growth of cancer cells in tissue culture, with high values (IC50) being seen at concentrations of 1-10 μM.</p>Formula:C9H21ClN2O2Purity:Min. 95%Molecular weight:224.73 g/molBiotinyl-ε-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone
CAS:<p>Please enquire for more information about Biotinyl-epsilon-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56ClN9O6SPurity:Min. 95%Molecular weight:790.42 g/mol5,7-Dichloro-8-hydroxyquinaldine
CAS:<p>5,7-Dichloro-8-hydroxyquinaldine is an antimicrobial agent that can be used to treat infections caused by Gram-negative bacteria. It has been shown to have a broad spectrum of activity against both aerobic and anaerobic bacteria. 5,7-Dichloro-8-hydroxyquinaldine is active against methicillin resistant Staphylococcus aureus (MRSA) and Enterococci species. The drug has been shown to be effective in treating tissue infections in women with menstrual blood flow due to its anti-inflammatory properties. This drug is not absorbed well into the body via oral administration and is not widely available outside of China.</p>Formula:C10H7Cl2NOPurity:Min. 95%Color and Shape:PowderMolecular weight:228.07 g/mol5-Bromo-3-fluorophenol
CAS:<p>5-Bromo-3-fluorophenol is a chemical compound that is modified by hydrogen bonding. It displays anti-cancer activity against various human cancer cells, including breast and prostate cancer cells. 5-Bromo-3-fluorophenol also inhibits nicotinic acetylcholine receptors and the enzyme acetylcholinesterase, which are important for the function of the nervous system. This drug has been shown to interact with acetylcholine receptor sites on the surface of tumor cells, which may lead to apoptosis. The pharmacophore for 5-bromo-3-fluorophenol is a phenolic OH group linked to an aromatic ring with two nitro groups.</p>Formula:C6H4BrFOPurity:Min. 95%Color and Shape:PowderMolecular weight:191 g/molOsteogenic Growth Peptide (10-14) trifluoroacetate salt
CAS:<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>Formula:C24H29N5O7Purity:Min. 95%Molecular weight:499.52 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molSuc-Ala-Ala-Pro-Phe-2,4-difluoroanilide
CAS:<p>Please enquire for more information about Suc-Ala-Ala-Pro-Phe-2,4-difluoroanilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H35F2N5O7Purity:Min. 95%Molecular weight:615.63 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H116N20O19SPurity:Min. 95%Molecular weight:1,657.93 g/mol(D-Trp8)-Somatostatin-14 trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H104N18O19S2Purity:Min. 95%Molecular weight:1,637.88 g/molH-D-Ser-OBzl hydrochloride salt
CAS:<p>H-D-Ser-OBzl hydrochloride salt is a monoclonal antibody that inhibits the activity of an enzyme called fatty acid synthase (FAS). It also binds to glycoconjugates, which are molecules that are involved in the inflammatory response. H-D-Ser-OBzl hydrochloride salt is used to treat various types of inflammatory diseases, such as arthritis and Crohn's disease. H-D-Ser-OBzl hydrochloride salt has been shown to inhibit tumor cell growth by binding to an enzyme called fatty acid synthase. H-D-Ser-OBzl hydrochloride salt also inhibits the production of inflammatory mediators, such as prostaglandins, leukotrienes and thromboxanes. The antiinflammatory effect of this drug may be due to its ability to inhibit prostaglandin synthesis.</p>Formula:C10H13NO3Purity:Min. 95%Molecular weight:195.22 g/mol2-Bromo-6-methylpyridine-3-carboxaldehyde
CAS:<p>2-Bromo-6-methylpyridine-3-carboxaldehyde (BMPCA) is a pharmacological agent that belongs to the group of antagonists. It has been shown to be a potent antagonist at the NMDA receptor and may be used for treating neuropathic pain. BMPCA also has been shown to have competitive inhibition at the naphthyridine receptor, which may allow it to act as an antagonist or an agonist depending on its binding site. The regioisomeric analogs of BMPCA are 2-(2,5-dichloropyridyl)-6-methylpyridine-3-carboxaldehyde and 2-(2,5-dimethylpyridyl)-6-methylpyridine-3-carboxaldehyde. These analogs have been shown to inhibit the growth of tumor cells in vitro and in vivo.</p>Formula:C7H6BrNOPurity:Min. 95%Molecular weight:200.03 g/mol4-Bromo-6-chloropyridazin-3(2H)-one
CAS:<p>4-Bromo-6-chloropyridazin-3(2H)-one is a glycosylation inhibitor and nucleoside analog that can be used in the treatment of cancer. It inhibits the synthesis of deoxyribonucleotides from ribonucleotides by binding to the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxynucleotides. 4-Bromo-6-chloropyridazin-3(2H)-one has been shown to inhibit glycosylation in rat liver cells. This drug also inhibits acetone and glycosidation, which are reactions that produce glucose from amino acids or carbohydrates. The crystallization process is also inhibited by this drug because it prevents the formation of nucleoside crystals, which are involved in DNA replication and cell division.</p>Formula:C4H2BrClN2OPurity:Min. 95%Molecular weight:209.43 g/mol(β-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H238N44O42SPurity:Min. 95%Molecular weight:3,325.8 g/molEndothelin-2 (human, canine) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C115H160N26O32S4Purity:Min. 95%Molecular weight:2,546.92 g/molH-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H32N8O9Purity:Min. 95%Molecular weight:504.5 g/molH-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution)
<p>Please enquire for more information about H-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/molH-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt
CAS:<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>Formula:C26H42N8O8Purity:Min. 95%Molecular weight:594.66 g/mol5-Bromoquinolin-6-amine
CAS:<p>Please enquire for more information about 5-Bromoquinolin-6-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H7BrN2Purity:Min. 95%Molecular weight:223.07 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molLIP2 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H288N58O58Purity:Min. 95%Molecular weight:4,240.61 g/molBis-ACV trifluoroacetate salt
CAS:<p>Bis-ACV trifluoroacetate salt is a regulatory compound that belongs to the class of bis-acids. It is a cytosolic calcium ionophore that binds to the cytosolic calcium ion channel and regulates its activity. Bis-ACV trifluoroacetate salt also has nucleophilic attack on phosphate groups, which are essential for biosynthesis. The enzyme activity of this compound has been studied in various strains of bacteria such as E. coli and S. cerevisiae, and it was found to be involved in the synthesis of oligosaccharides and polysaccharides. This compound can be solubilized by the addition of sodium bicarbonate or urea, which facilitates its use in synthetic reactions. The synthase gene for this compound has been identified from various strains of bacteria such as E. coli and S. cerevisiae, but not from mammalian cells or plants.</p>Formula:C28H48N6O12S2Purity:Min. 95%Molecular weight:724.85 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Formula:C50H73N13O11Purity:Min. 95%Molecular weight:1,032.2 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/mol6-Fluoro-3,4-Pyridinediamine
CAS:<p>Please enquire for more information about 6-Fluoro-3,4-Pyridinediamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H6FN3Purity:Min. 95%Molecular weight:127.12 g/mol2,3,4,5-Tetrafluorobenzoic acid
CAS:<p>Tetrafluorobenzoic acid is a synthetic chemical that is used in the synthesis of antimicrobial agents. Tetrafluorobenzoic acid has been shown to bind to the hydroxyl group of 2,3,4,5-tetrafluorobenzoyl chloride and form a covalent bond. The reaction solution was analyzed using crystallography and showed that there are no intermolecular hydrogen bonds between tetrafluorobenzoic acid molecules. The crystal structure was determined by X-ray diffraction analysis and found that the intramolecular hydrogen bonding may be responsible for the anti-microbial activity of this substance.</p>Formula:C7H2F4O2Molecular weight:194.08 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/mol(D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C158H265N49O43Purity:Min. 95%Molecular weight:3,539.1 g/mol2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4BF4NO2Purity:Min. 95%Molecular weight:208.91 g/mol(S)-(+)-6,6'-Dibromo-1,1'-bi-2-naphthol
CAS:<p>Used in the synthesis of 6,6'-substituted BINOL chiral ligands</p>Formula:C20H12Br2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:444.12 g/mol2-Bromo-6-chlorophenol
CAS:<p>2-Bromo-6-chlorophenol is a reactive, thiourea-containing compound that undergoes catalytic reactions. 2-Bromo-6-chlorophenol reacts with sulfate in water to form chlorine radicals, which react with other organic compounds to produce chlorinated organic compounds. This reaction can be used for the oxidation of phenols and alcohols to yield chlorinated products. The yields of this process depend on the concentration of acetonitrile used in the reaction. Acetonitrile is also required for the conversion of dichlorinated benzenes to brominated products.</p>Formula:C6H4BrClOPurity:Min. 95%Molecular weight:207.45 g/mol3-Bromobenzaldehyde
CAS:<p>3-Bromobenzaldehyde is an organic compound with the formula CHBrCHO. It is a colorless liquid that is soluble in many organic solvents. 3-Bromobenzaldehyde can be synthesized by the reaction of ethyl acetoacetate and anhydrous sodium in methanol, and can be purified by distillation or recrystallization from ethanol. This compound has been used as a solvent for analytical methods, such as GC-MS analysis, due to its high boiling point and low volatility. 3-Bromobenzaldehyde also reacts with hydrogen chloride to form benzoyl chloride, which can then be reacted with alcohols to produce esters. 3-Bromobenzaldehyde has been shown to react with chalcones to form optical active compounds, such as curcumin analogues. These reactions are typically carried out in solution using acetic acid or sulfuric acid as a catalyst.br>br></p>Formula:C7H5BrOPurity:Min. 95%Molecular weight:185.02 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/mol4-Chlorophenyl-2-pyridinylmethanol
CAS:<p>Please enquire for more information about 4-Chlorophenyl-2-pyridinylmethanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H10ClNOPurity:Min. 95%Molecular weight:219.67 g/molSodium fluoroacetate
CAS:<p>Sodium fluoroacetate is a salt that is synthesized by the reaction of methyl ethyl and sodium trifluoroacetate. It has been used as an insecticide, but also has been used to treat metabolic disorders such as bowel disease and eye disorders. Sodium fluoroacetate also has been used in natural products for the treatment of autoimmune diseases. The toxicological studies of sodium fluoroacetate have shown that it can cause eye disorders and x-ray crystal structures have revealed its mechanism of action.</p>Formula:C2H2FNaO2Color and Shape:White PowderMolecular weight:100.02 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/molMethyl 2,3-diamino-5-bromobenzoate
CAS:<p>Please enquire for more information about Methyl 2,3-diamino-5-bromobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H9BrN2O2Purity:Min. 95%Molecular weight:245.07 g/molZ-Tyr-Val-Ala-Asp-chloromethylketone
CAS:<p>Z-Tyr-Val-Ala-Asp-chloromethylketone is a fluorescent probe that can be used for the detection of phosphatidic acid. It is also an apoptosis inducer, which means that it promotes cell death. Z-Tyr-Val-Ala-Asp-chloromethylketone induces apoptosis by binding to the kinases and causing their activation, leading to phosphatidic acid production. This process is activated by the presence of ethylene, which binds to Z-Tyr-Val-Ala-Asp chloromethylketone and stabilizes its structure.</p>Formula:C30H37ClN4O9Purity:Min. 95%Molecular weight:633.09 g/molVEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H99N23O18SPurity:Min. 95%Molecular weight:1,666.82 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H71ClN12O8S2Purity:Min. 95%Molecular weight:1,175.86 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/mol(1R,3S)-3-Aminocyclopentanol hydrochloride
CAS:<p>Intermediate in the synthesis of bictegravir</p>Formula:C5H12ClNOPurity:Min. 95%Molecular weight:137.61 g/molZ-2-Nal-chloromethylketone
CAS:<p>Please enquire for more information about Z-2-Nal-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H20ClNO3Purity:Min. 95%Molecular weight:381.85 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>Formula:C25H42N10O11SPurity:Min. 95%Molecular weight:690.73 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H270N48O51S2Purity:Min. 95%Molecular weight:4,046.55 g/mol1-Fluoro-2,4,6-trimethylpyridinium trifluoromethanesulfonate
CAS:<p>Gabapentin is a pharmaceutical preparation that is used for the treatment of epilepsy and neuropathic pain. It is also used for postherpetic neuralgia, bipolar disorder, and anxiety disorders. Gabapentin has been shown to bind reversibly to the enzyme adenylate cyclase, which regulates the production of the second messenger cAMP. The binding of gabapentin to this enzyme prevents the conversion of ATP into cAMP and blocks signal transduction. This leads to an increase in intracellular levels of adenine nucleotides (ATP) and suppression of neuronal activity. Gabapentin has high values in kinetic tests because it is a reversible inhibitor with a low Km value. It binds irreversibly to nucleophilic substitutions, which are enzymes that catalyze reactions involving hydrolysis or transfer of one or more hydrogen ions from one molecule to another in a chemical reaction. A fluorine atom on gabapentin's structure may account for its</p>Formula:C9H11F4NO3SPurity:85%MinColor and Shape:PowderMolecular weight:289.25 g/molAcetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H63N9O8Purity:Min. 95%Molecular weight:822.01 g/molMethyl 2-bromo-2-(4-chlorophenyl)acetate
CAS:<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>Formula:C9H8BrClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:263.52 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/mol6-Bromoisoquinoline
CAS:<p>6-Bromoisoquinoline is a tetradentate ligand that can be used as a molecular model to study the binding of metal ions and organic molecules. 6-Bromoisoquinoline has been shown to bind covalently and noncovalently with phosphate groups on the surface of Caco-2 cells and to induce surface-enhanced Raman spectroscopy. This ligand has a high nucleophilicity and reacts readily with chloride, which is an acidic functional group. The reaction products are hydrochloric acid, trifluoroacetic acid, or both. 6-Bromoisoquinoline can also act as an allosteric modulator in some enzymes, such as phosphofructokinase in glycolysis.</p>Formula:C9H6BrNPurity:Min. 95%Molecular weight:208.05 g/molNeuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H180N32O38Purity:Min. 95%Molecular weight:2,558.8 g/mol4-Bromo-2-pyrrolecarboxaldehyde
CAS:<p>4-Bromo-2-pyrrolecarboxaldehyde is a synthetic chemical that is used as an antifungal agent. It inhibits the growth of filamentous fungi by binding to their pyrrole rings and inhibiting the synthesis of proteins. 4-Bromo-2-pyrrolecarboxaldehyde has shown in vitro antifungal activity against isolates of Candida albicans, Aspergillus niger, and Fusarium oxysporum. This compound also has substitutions at positions 1 and 2 of the pyrrole ring, which are thought to be responsible for its inhibitory properties. 4-Bromo-2-pyrrolecarboxaldehyde is soluble in organic solvents such as acetone and chloroform.</p>Formula:C5H4BrNOPurity:Min. 95%Color and Shape:PowderMolecular weight:174 g/molDefensin HNP-2 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-2 is a peptide that has been shown to bind to cancer cells, metabolic disorders, and endometriosis. It also has pharmaceutical preparations for treating microbial infection and other diseases. Defensin HNP-2 is a broad-spectrum antimicrobial peptide and it binds to bacterial membranes in the cell cytoplasm. Defensin HNP-2 may be used as diagnostic agents or in the treatment of microbial infections. This antimicrobial peptide is stable when complexed with calcium ions and can be used against s. aureus strains that are resistant to antibiotics such as ciprofloxacin.</p>Formula:C147H217N43O37S6Purity:Min. 95%Molecular weight:3,370.96 g/mol5-Chloro-8-hydroxyquinoline
CAS:<p>5-Chloro-8-hydroxyquinoline (5-CQ) is a quinoline derivative that has been used as an anticancer agent. It binds to DNA and inhibits the synthesis of RNA and proteins, leading to cell death. 5-CQ has been shown to be cytotoxic against skin cells in vitro by inhibiting mitochondrial oxidative phosphorylation and decreasing the mitochondrial membrane potential. This compound also has genotoxic effects on cultured choroidal neovascularization cells through the inhibition of DNA synthesis.<br>5-CQ binds to DNA via hydrogen bonds with nitrogen atoms in the purine ring of nucleobases. The overall geometry is that of a distorted octahedron with two faces, each containing six nitrogens in square planar coordination geometry. The binding constants are low for purines but high for pyrimidines, which is why 5-CQ preferentially targets purine rich regions of the genome.</p>Formula:C9H6ClNOPurity:Min. 95%Color and Shape:Green To Grey SolidMolecular weight:179.6 g/mol4-(Piperidin-4-yl)benzoic acid hydrochloride
CAS:<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16ClNO2Purity:Min. 95%Molecular weight:241.71 g/molH-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35ClN4O3Purity:Min. 95%Molecular weight:390.95 g/mol4-(2-Bromoethyl)-1,3-dihydro-2H-indolin-2-one
CAS:<p>Please enquire for more information about 4-(2-Bromoethyl)-1,3-dihydro-2H-indolin-2-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H10BrNOPurity:Min. 95%Color and Shape:PowderMolecular weight:240.1 g/molTrimethylsulfoxonium bromide
CAS:<p>Trimethylsulfoxonium Bromide is a fungicide that inhibits the growth of fungal cells. It binds to the sterol biosynthesis pathway and disrupts the production of ergosterol, which is an essential component for fungal cell membranes. Trimethylsulfoxonium Bromide has been shown to be effective against chronic bronchitis and other pulmonary diseases. This drug also has a horticultural use as a plant growth regulator. The chemical formula for Trimethylsulfoxonium Bromide is C1-C4-haloalkyl, profile, tebuconazole, fluconazole, triethyl orthoformate, chronic bronchitis, carbonyl group, hydroxyl group, anti-fungal.</p>Formula:C3H9BrOSPurity:Min. 95%Molecular weight:173.07 g/mol1-Methylbiguanide hyrdochloride
CAS:<p>1-Methylbiguanide hydrochloride is a pharmaceutical drug that has been shown to be an antidiabetic agent. It is a white crystalline powder with a melting point of about 180°C and a solubility in water of about 1 g/L. 1-Methylbiguanide hydrochloride is used for treating diabetes mellitus type 2, which is caused by insulin resistance. The drug works by stimulating the release of insulin from the pancreas and increasing the rate at which glucose enters cells. Studies have shown that 1-methylbiguanide hydrochloride has low biodegradability, but it can be removed from wastewater using an activated carbon column or hydrophilic interaction chromatography. 1-Methylbiguanide hyrdochloride has been shown to be safe for humans and may not cause side effects in people with kidney disease who take it as prescribed. This drug also does not interact with other medications, such as warfarin</p>Formula:C3H9N5·HClPurity:Min. 95%Molecular weight:151.6 g/molMethyl 2-amino-6-bromobenzoate
CAS:<p>Please enquire for more information about Methyl 2-amino-6-bromobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BrNO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:230.06 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C292H451N83O84SPurity:Min. 95%Molecular weight:6,500.28 g/mol
