Organic Halides

<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>1-Chloroethyl isopropyl carbonate (CEPC) is a cefpodoxime proxetil metabolite that is formed from the chlorination of 1-chloroacetamide in the presence of isopropyl. CEPC has been shown to have a high yield and can be synthesized from readily available, inexpensive starting materials. It is metabolized by human liver microsomes and plasma, yielding 7-aminocephalosporanic acid, cefpodoxime, and thiourea. This compound can also be used as an intermediate for the synthesis of other compounds such as cefotaxime and thiourea.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Tyr-Val-Ala-DL-Asp-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>8-Bromo-1-octanol is a fluorescent compound that has been shown to be resistant to cancer. It can be used as a probe for the detection of malonic acid in urine samples, which are an indicator of oxidative stress. 8-Bromo-1-octanol is stable in the presence of alcohol groups, and can be used to prepare samples for population growth studies. This chemical has also been used to study the growth of bacteria such as Pseudomonas aeruginosa and Escherichia coli. 8-Bromo-1-octanol emits light at a wavelength of 490 nm when exposed to ultraviolet radiation, which makes it useful for detecting chlorine atoms in water samples. The product research involving this chemical includes its effects on k562 cells and P. aeruginosa. Studies have also been done on its hydroxyl group and fatty acids and fatty acid esters, which are found in animal fat and vegetable oils.</p>

<p>Methyl 3,5-dichloro-4-methoxybenzoate is a fine chemical and useful building block for research chemicals. It belongs to the class of speciality chemicals and can be used as a reagent in organic synthesis. Methyl 3,5-dichloro-4-methoxybenzoate is a versatile building block that has been reported in the synthesis of many complex compounds. This compound can also be used as an intermediate or scaffold for medicinal chemistry applications.</p>

<p>Tetrafluorophthalic anhydride is a chemical compound that belongs to the class of anhydrides. It inhibits the activity of sodium carbonate, which is essential for the production of sodium bicarbonate in the human body. The inhibitory properties of tetrafluorophthalic anhydride are derived from its ability to form hydrogen bonds with zirconium oxide. Tetrafluorophthalic anhydride has been shown to have antiangiogenic properties due to its hydroxyl group and hydrophobic effect.<br>br&gt;<br>Tetrafluorophthalic anhydride has also been shown to inhibit the photochemical reaction in x-ray diffraction data and acid analysis data, as well as chlorine atom or boron nitride.</p>

<p>Please enquire for more information about 5'-Chloro-2'-hydroxy-3'-nitro-[1,1'-biphenyl]-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt H-Tyr-D-Ala-Gly-N-Me-Phe-methionin(O)-ol trifluoroacetate salt is an analog of the endocannabinoid neurotransmitter, anandamide. It has been shown to be effective in the treatment of autoimmune diseases such as multiple sclerosis and inflammatory bowel disease. D-(3R)-3-[(1S,2R,3R,5R) -3-[2-(2,6 dichlorophenyl)ethenyl] -1H -indole]-1 -butanamine trifluoroacetate salt has been shown to inhibit the replication of a number of viruses including human immunodeficiency virus type 1 (HIV). This drug also inhibits the growth of organisms that are resistant</p>

<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>

<p>Please enquire for more information about Mca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of osimertinib (AZD9291)</p>

<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6-Bromoindazole is a hydrogen bond inhibitor that has potential neuroprotective effects. It inhibits the enzyme DNA Gyrase, which is necessary for bacterial replication, and has antibacterial properties. 6-Bromoindazole interacts with the receptor tyrosine kinase axitinib and inhibits its activity. This interaction may be responsible for its neuroprotective effects.</p>

<p>1-Bromo-2,5-difluorobenzene is an amide that is used as a grignard reagent. It is also a halogenated organic chemical that is used in the manufacture of semiconductors and other chemicals. 1-Bromo-2,5-difluorobenzene has been shown to be resistant to oxidation and can be used in the preparation of synthetic processes. This chemical may be prepared by reacting sodium chloride with phosphorus pentachloride in the presence of benzene or chlorobenzene. The bromine atom may then be substituted for fluorine by reaction with silver fluoride or potassium fluoride. The product may then be purified by recrystallization from solvents such as ether, benzene, or toluene.</p>

<p>Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methyl-6-(trifluoromethyl)aniline is a colorless, oily liquid with a sulfurous odor. It is soluble in water and alcohol. The reaction rate of 2-methyl-6-(trifluoromethyl)aniline with sulfoxides is faster than that of benzyl anilines, but slower than that of anilino derivatives. The addition of hydrophobic groups to the 2-methyl-6-(trifluoromethyl)aniline molecule increases the reaction rate. 2-Methyl-6-(trifluoromethyl)aniline can be used as an anesthetic agent because it is a potent inhibitor of nerve conduction in sciatic nerves. It also has been shown to be effective in desulfurizing propylene, which is important for the production of polypropylene plastics and synthetic rubber. 2-Methyl-6-(triflu</p>

<p>2-(3,4-Dichlorophenyl)ethanol is a high quality reagent for the synthesis of complex compounds, useful as an intermediate in organic synthesis and as a building block for speciality chemicals. This chemical is also used as a research chemical in the synthesis of versatile building blocks. It can be used as a reaction component in various reactions such as Suzuki coupling, Negishi coupling, Heck reaction, and Sonogashira coupling.</p>

<p>Please enquire for more information about (2E)-1-[5,6-Dihydro-3-(trifluoromethyl)-1,2,4-triazolo[4,3-a]pyrazin-7(8H)-yl]-4-(2,4,5-trifluorophenyl)-2-buten-1-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6-Bromo-tetral-1-one is a chemical compound with a molecular formula of C8H6BrO. It is synthesized by the ring opening of epichlorohydrin with boron trifluoride etherate (BF3OEt2) in pyridine at 0°C, followed by hydrolysis of the resulting epoxide with sodium hydroxide to give tetralin. The synthesis can be carried out on a laboratory scale using high purity chemicals and yields up to 100% conversion of the starting material to tetralin. 6-Bromo-tetral-1-one has been shown to be stable in air, moisture, and light. This product is also nonflammable and produces no toxic byproducts when heated to decomposition.</p>

<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>

<p>2-Amino-6-(trifluoromethyl)benzothiazole is a new, optimised insecticide with alkylthio, halogen and alkoxy groups. It is highly toxic to insects and has been shown to be active against various species of Lepidoptera, Coleoptera and Diptera. 2-Amino-6-(trifluoromethyl)benzothiazole is also a broad spectrum contact insecticide that exhibits systemic properties. This insecticide can be used on plants, crops, livestock and pets.</p>

<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Berberine chloride hydrate is an isoquinoline alkaloid, which is a natural compound derived from various plants, such as Berberis species, with a robust pharmacological profile. Its mode of action is primarily through the modulation of multiple biochemical pathways. Berberine activates adenosine monophosphate-activated protein kinase (AMPK), a crucial regulator of energy homeostasis, and influences lipid and glucose metabolism. It exhibits significant antimicrobial activity, disrupting microbial cell walls and inhibiting the nucleic acid synthesis of pathogens.</p>

<p>Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone is a small molecule that has been shown to induce apoptosis in cultured cells. It is a caspase-3 inhibitor, which prevents the activation of the caspase cascade and protects cells from oxidative injury. Low doses of Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone have been shown to induce apoptosis in cultured cells, with no significant cytotoxicity at high doses. The mechanism of action for this agent is not yet known, but it may promote mitochondrial membrane potential loss and neuronal death by binding to DNA, or induce cell death through a caspase-independent pathway.</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chloro-4-hydroxybenzyl alcohol is an organic compound that has been shown to be soluble in aqueous alkali metal solutions, but insoluble in water. It is also insoluble in polymer solvents such as acetone and ethyl ether. 2-Chloro-4-hydroxybenzyl alcohol is a sugar alcohol with 3 hydroxyl groups. The molecule has a molecular weight of 150.17 g/mol, melting point of -123°C (-198°F), boiling point of 179°C (354°F), and refractive index of 1.5774 at 20°C (68°F). This chemical can be used in the synthesis of polyhydric alcohols such as glycerol or hexanol. 2-Chloro-4-hydroxybenzyl alcohol is not soluble in hydrochloric acid, benzene or chloroform, and does not react to form any es</p>

<p>Please enquire for more information about H-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-e psilon-aminocaproyl-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Maleimide is a chemical compound with the molecular formula CH2=C(O)NHC(=O)CH2-CO2H. It is a reactive monomer that polymerizes in the presence of an initiator to form polymers. Maleimides are also used as cross-linking agents, and have been shown to be thermostable and stable at high temperatures. This particular maleimide is a colorless solid that has been shown to copolymerize with methyl methacrylate and other monomers to form thermally stable, hydrophobic polymers.</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ser(tBu)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (394-410) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromo-5-(trifluoromethyl)aniline is a synthetically useful compound that can be used for the synthesis of other organic compounds. It has been shown to react with nilotinib, an anticancer drug, to produce a reaction yield of 83%. This reaction was carried out in an impure environment and produced some impurities. The reaction was conducted using acetonitrile as the solvent and the desired product was obtained by using a high-performance liquid chromatography (HPLC) method. The resulting product was deuterated with deuterium gas. 3-Bromo-5-(trifluoromethyl)aniline is insoluble in water and soluble in organic solvents such as benzene, chloroform, dichloromethane, acetonitrile, and ether. The chemical formula for this substance is C8H4BrF3NO2.</p>

<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>