Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,085 products)
- By Biological Target(99,070 products)
- By Pharmacological Effects(6,784 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,693 products)
- Secondary Metabolites(14,217 products)
Found 130575 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-TLSDYNIQK-OH
<p>Peptide H-TLSDYNIQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLEAELLVLR-OH
<p>Peptide H-VLEAELLVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RYLKNGKETL-OH
<p>Peptide H-RYLKNGKETL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRMKVAKNAQ-OH
<p>Peptide H-KRMKVAKNAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHDGLYQGLSTATK-OH
<p>Peptide H-GHDGLYQGLSTATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GCPPDDIENPR-OH
<p>Peptide H-GCPPDDIENPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTHWFVTQR-OH
<p>Peptide H-GTHWFVTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQEAGTEVVK-OH
<p>Peptide H-IQEAGTEVVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VETPIRNEW-OH
<p>Peptide H-VETPIRNEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSWMEEVIK-OH
<p>Peptide H-DSWMEEVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDSSESSDSGSSSESDGD-OH
<p>Peptide H-DDSSESSDSGSSSESDGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLWHYPCTI-OH
<p>Peptide H-RLWHYPCTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNGSCGSVGF-OH
<p>Peptide H-LNGSCGSVGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-INQLISETEAVVTNELEDGR-OH
<p>Peptide H-INQLISETEAVVTNELEDGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLLLLK-OH
<p>Peptide H-KLLLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSGFGNFDLR-OH
<p>Peptide H-LSGFGNFDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSDLIVLGLPWK-OH
<p>Peptide H-TSDLIVLGLPWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVQPLLLGR-OH
<p>Peptide H-AVQPLLLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEDGVLDPDYPR-OH
<p>Peptide H-FEDGVLDPDYPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANQECDVT-OH
<p>Peptide H-ANQECDVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APAATVVNVDEVR-OH
<p>Peptide H-APAATVVNVDEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-pFR-OH
<p>Peptide H-pFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QIFGDYK-OH
<p>Peptide H-QIFGDYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASNENMDTM-OH
<p>Peptide H-ASNENMDTM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDDDDDDDDD-OH
<p>Peptide H-DDDDDDDDDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AESPKKP-OH
<p>Peptide H-AESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TQIQSVEPYTK-OH
<p>Peptide H-TQIQSVEPYTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Palifosfamide
CAS:<p>Active metabolite of ifosfamide; alkylates and cross-links DNA; antineoplastic</p>Formula:C4H11Cl2N2O2PPurity:Min. 95%Color and Shape:SolidMolecular weight:221.02 g/molH-CVNGVCWTV-OH
<p>Peptide H-CVNGVCWTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MPFEF-OH
<p>Peptide H-MPFEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVTELNEPLSNEER-OH
<p>Peptide H-NVTELNEPLSNEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RMYNPTNIL-OH
<p>Peptide H-RMYNPTNIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGKLLSTAAGLLSNL-OH
<p>Peptide H-ILGKLLSTAAGLLSNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHPFH-NH2
<p>Peptide H-DRVYIHPFH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPDWQNYTP-OH
<p>Peptide H-FPDWQNYTP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGLPLEEVTVAEVLAAR-OH
<p>Peptide H-GGLPLEEVTVAEVLAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVFFAEDVGSN-OH
<p>Peptide H-KLVFFAEDVGSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEAEIATYR-OH
<p>Peptide H-LEAEIATYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAVQATKPDMR-OH
<p>Peptide H-DAVQATKPDMR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRLFKEFLFSLRKY-OH
<p>Peptide H-KRLFKEFLFSLRKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTASWFTAL-OH
<p>Peptide H-NTASWFTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLRSSVPGVR-OH
<p>Peptide H-RLRSSVPGVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMQMLKETI-OH
<p>Peptide H-AMQMLKETI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PEP2-8 trifluoroacetate
CAS:<p>Peptide Ac-TVFTSWEEYLDWV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C83H110N16O24·xC2HF3O2Color and Shape:PowderMolecular weight:1,715.85 g/molH-EGVVAAAEK-OH
<p>Peptide H-EGVVAAAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQEVAGSLIFR-OH
<p>Peptide H-IQEVAGSLIFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVNLPGAAVDLPAVSEK-OH
<p>Peptide H-GVNLPGAAVDLPAVSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELGPYTLDR-OH
<p>Peptide H-ELGPYTLDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLQQFPLDLEK-OH
<p>Peptide H-LLQQFPLDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGP-OH
<p>Peptide H-GPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGATPQDLNTMLNTV-OH
<p>Peptide H-EGATPQDLNTMLNTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WAICKRIPNKKPGKK-OH
<p>Peptide H-WAICKRIPNKKPGKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPVITGAPYEYR-OH
<p>Peptide H-TPVITGAPYEYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQDAGVYR-OH
<p>Peptide H-LQDAGVYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVYNFATCGI-OH
<p>Peptide H-AVYNFATCGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WCFR-OH
<p>Peptide H-WCFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITPSYVAFTPEGER-OH
<p>Peptide H-ITPSYVAFTPEGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VRGRHEAYLCYE-OH
<p>Peptide H-VRGRHEAYLCYE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPLVPALDGCLR-OH
<p>Peptide H-LPLVPALDGCLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DASGATFTWTPSSGK-OH
<p>Peptide H-DASGATFTWTPSSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYAVLPTGDVIGDSAK-OH
<p>Peptide H-LLIYAVLPTGDVIGDSAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CUBIC-HV™1 3D nuclear staining kit
Purity:min. 95.0 area%(HPLC)Color and Shape:Colorless - Almost Colorless LiquidH-FAGVFHVEK-OH
<p>Peptide H-FAGVFHVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVALGINAV-OH
<p>Peptide H-KLVALGINAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGQQQPFPPQQPYPQPQPF-OH
<p>Peptide H-LGQQQPFPPQQPYPQPQPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITT-OH
<p>Peptide H-ITT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVIQHFQEK-OH
<p>Peptide H-AVIQHFQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FR-OH
<p>Peptide H-FR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QFPILLDFK-OH
<p>Peptide H-QFPILLDFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YRKEQQSAVDADD-OH
<p>Peptide H-YRKEQQSAVDADD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYAQKIFKIL-OH
<p>Peptide H-AYAQKIFKIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFEPGVTNILK-OH
<p>Peptide H-GFEPGVTNILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QARVLAVERYLKDQQ-OH
<p>Peptide H-QARVLAVERYLKDQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQAEEELIK-OH
<p>Peptide H-NQAEEELIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SCDK-OH
<p>Peptide H-SCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRPEYTPIHLS-OH
<p>Peptide H-CRPEYTPIHLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK-OH
<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VADFGLARLIEDNEYTARQGAK-OH
<p>Peptide H-VADFGLARLIEDNEYTARQGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEKRGSLYVW-OH
<p>Peptide H-EEKRGSLYVW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MAIPPKKNQDKTEIPTINT-OH
<p>Peptide H-MAIPPKKNQDKTEIPTINT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIFACHEK-OH
<p>Peptide H-LIFACHEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGDNNLTRIVGGQE-OH
<p>Peptide H-RGDNNLTRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLHQLADLV-OH
<p>Peptide H-LLHQLADLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLDLAALIVYWEMEDK-OH
<p>Peptide H-QLDLAALIVYWEMEDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CNTSTITQACPKVSF-OH
<p>Peptide H-CNTSTITQACPKVSF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPYVG-OH
<p>Peptide H-GPYVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSGF-OH
<p>Peptide H-GSGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KHKILHRLLQDSSS-OH
<p>Peptide H-KHKILHRLLQDSSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVLQTM-OH
<p>Peptide H-LVLQTM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEKTKKNLSKLLNEEAN-OH
<p>Peptide H-CEKTKKNLSKLLNEEAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSGFEDELSEVLENQSSQAELK-OH
<p>Peptide H-HSGFEDELSEVLENQSSQAELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLTPTQVK-OH
<p>Peptide H-VLTPTQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTHFPICIFCCGCCHRSKCGMCCKT-OH
<p>Peptide H-DTHFPICIFCCGCCHRSKCGMCCKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RFPLTFGWCF-OH
<p>Peptide H-RFPLTFGWCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHQAAMQMLKETINE-OH
<p>Peptide H-GHQAAMQMLKETINE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GKSLYESWTKK-OH
<p>Peptide H-GKSLYESWTKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPEATPTELAK-OH
<p>Peptide H-LPEATPTELAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYQRTRALVTG-OH
<p>Peptide H-TYQRTRALVTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LERKGT-OH
<p>Peptide H-LERKGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTFGWCYKL-OH
<p>Peptide H-LTFGWCYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSPWFTTL-OH
<p>Peptide H-KSPWFTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVVYPWTRRF-OH
<p>Peptide H-LVVYPWTRRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELTLGEFLKL-OH
<p>Peptide H-ELTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGLEPINFQTAADQAR-OH
<p>Peptide H-GGLEPINFQTAADQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PMPF-OH
<p>Peptide H-PMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYNTIAVL-OH
<p>Peptide H-SLYNTIAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLQEAAEER-OH
<p>Peptide H-GLQEAAEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTDPSFLGRY-OH
<p>Peptide H-TTDPSFLGRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,156.3 g/molN-Acetyl-DL-penicillamine
CAS:<p>Protective agent against mercuric chloride poisoning</p>Formula:C7H13NO3SPurity:Min. 95%Color and Shape:PowderMolecular weight:191.25 g/molH-SGEATDGARPQALPEPMQESK-OH
<p>Peptide H-SGEATDGARPQALPEPMQESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH
<p>Peptide H-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVVTVIDVFYK-OH
<p>Peptide H-SVVTVIDVFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAVVNQIAL-OH
<p>Peptide H-VAVVNQIAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGSDTITLPCRIKQFINMWQE-OH
<p>Peptide H-EGSDTITLPCRIKQFINMWQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EAKLNREEI-OH
<p>Peptide H-EAKLNREEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAIETDKEYYTVKD-OH
<p>Peptide H-KAIETDKEYYTVKD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLDYKPLSV-OH
<p>Peptide H-TLDYKPLSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WFDV-OH
<p>Peptide H-WFDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAPQLSTEELVSLGEK-OH
<p>Peptide H-IAPQLSTEELVSLGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CQPLGMISLMK-OH
<p>Peptide H-CQPLGMISLMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGSVIDQSR-OH
<p>Peptide H-SGSVIDQSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVTVTAEALR-OH
<p>Peptide H-FVTVTAEALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EHSSLAFWK-OH
<p>Peptide H-EHSSLAFWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEGLQEALLK-OH
<p>Peptide H-TEGLQEALLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVPDSLYV-OH
<p>Peptide H-KLVPDSLYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILENFPRL-OH
<p>Peptide H-ILENFPRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAVEEVSLRK-OH
<p>Peptide H-LAVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYPSYHSTPQRP-OH
<p>Peptide H-FYPSYHSTPQRP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MMWDRGLGMM-OH
<p>Peptide H-MMWDRGLGMM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGALNSNDAFVLK-OH
<p>Peptide H-AGALNSNDAFVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKLFKKILKYL-OH
<p>Peptide H-KKLFKKILKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,421.9 g/molH-RRRQRRKKRGYGGDHWIHFTANWV-OH
<p>Peptide H-RRRQRRKKRGYGGDHWIHFTANWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPTTPITTTYFFFKKK-OH
<p>Peptide H-IPTTPITTTYFFFKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTQSNFAVGYK-OH
<p>Peptide H-VTQSNFAVGYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFGNTLEDK-OH
<p>Peptide H-EFGNTLEDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLNQTDETL-OH
<p>Peptide H-FLNQTDETL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PIVTDKEKPVNIETE-OH
<p>Peptide H-PIVTDKEKPVNIETE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IEIYPTSLTK-OH
<p>Peptide H-IEIYPTSLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVMEYLPSGCLR-OH
<p>Peptide H-LVMEYLPSGCLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLDDFAMHWV-OH
<p>Peptide H-TLDDFAMHWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSATMHSSRYGYGYNC-OH
<p>Peptide H-DSATMHSSRYGYGYNC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GP-OH
<p>Peptide H-GP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDIALVQEVR-OH
<p>Peptide H-YDIALVQEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH
<p>Peptide H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLQEYQDLLNVK-OH
<p>Peptide H-HLQEYQDLLNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHFANLK-OH
<p>Peptide H-SHFANLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WGIDKAFFTTSTVTYKWFRY-OH
<p>Peptide H-WGIDKAFFTTSTVTYKWFRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TELLPGDRDNLAIQTR-OH
<p>Peptide H-TELLPGDRDNLAIQTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDAFKRSTDNKL-OH
<p>Peptide H-CDAFKRSTDNKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANTMAMMAR-OH
<p>Peptide H-ANTMAMMAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TRQRQGIVERC-OH
<p>Peptide H-TRQRQGIVERC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLQPQQPFPQQPQQPYPQQPQQPFPQ-OH
<p>Peptide H-FLQPQQPFPQQPQQPYPQQPQQPFPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNVENPK-OH
<p>Peptide H-LNVENPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVVVGADGV-OH
<p>Peptide H-LVVVGADGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
<p>Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NRLDRCLKAVRKER-OH
<p>Peptide H-NRLDRCLKAVRKER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSEHPTFTSQY-OH
<p>Peptide H-YSEHPTFTSQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QTDAAVKNWMTQTLL-OH
<p>Peptide H-QTDAAVKNWMTQTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLELYSQK-OH
<p>Peptide H-VLELYSQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDIDEIVLVGGSTR-OH
<p>Peptide H-SDIDEIVLVGGSTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSYRCPCRFF-OH
<p>Peptide H-LSYRCPCRFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETIPLQESTLYTEDR-OH
<p>Peptide H-ETIPLQESTLYTEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SAFPEITHA-OH
<p>Peptide H-SAFPEITHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLIDLPGITRV-OH
<p>Peptide H-TLIDLPGITRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
<p>Custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,422.5 g/molH-RIIPRHLQL-OH
<p>Peptide H-RIIPRHLQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WFDI-OH
<p>Peptide H-WFDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclosporin B
CAS:<p>Cyclosporin B is an antifungal and immunosuppressive cyclic peptide, which is derived from the fungus *Tolypocladium inflatum*. The compound is a member of the cyclosporin family, characterized by cyclic polypeptides with a unique arrangement of amino acids that enable its biological activity. Though its precise mode of action is not completely delineated, it is observed to influence cell growth and viability by potentially disrupting cellular communication or signal transduction pathways.</p>Formula:C61H109N11O12Purity:Min. 95%Color and Shape:PowderMolecular weight:1,188.59 g/molH-PLALEGSLQK-OH
<p>Peptide H-PLALEGSLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPRTAALGLL-OH
<p>Peptide H-GPRTAALGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGADMEDVCGR-OH
<p>Peptide H-LGADMEDVCGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFQATTLGLPLEISK-OH
<p>Peptide H-YFQATTLGLPLEISK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSALGFLR-OH
<p>Peptide H-DSALGFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGAVAEEVLAAIR-OH
<p>Peptide H-AGAVAEEVLAAIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SRPTEKT-OH
<p>Peptide H-SRPTEKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDNWDSVTSTFSK-OH
<p>Peptide H-LLDNWDSVTSTFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTDALNATR-OH
<p>Peptide H-VTDALNATR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEQHKITSY-OH
<p>Peptide H-YEQHKITSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAANLWPSPLMIKRSKKNSLALSLT-OH
<p>Peptide H-RAANLWPSPLMIKRSKKNSLALSLT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AKSANKNKKNKDKEYYV-OH
<p>Peptide H-AKSANKNKKNKDKEYYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLFLNHSENATAK-OH
<p>Peptide H-NLFLNHSENATAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSNK-OH
<p>Peptide H-VSNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IRFRFDGQPI-OH
<p>Peptide H-IRFRFDGQPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFMVFAHAQWK-OH
<p>Peptide H-EFMVFAHAQWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APYAGLIMI-OH
<p>Peptide H-APYAGLIMI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IATALVDTFAVAR-OH
<p>Peptide H-IATALVDTFAVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVPESGKDGEDARQ-OH
<p>Peptide H-CVPESGKDGEDARQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYELPDGQVITIGNER-OH
<p>Peptide H-SYELPDGQVITIGNER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPANPVQ-OH
<p>Peptide H-NPANPVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSHHHHHHSS-OH
<p>Peptide H-SSHHHHHHSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNHRFTLV-OH
<p>Peptide H-VNHRFTLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQGFTEDTIVFLPQTDK-OH
<p>Peptide H-AQGFTEDTIVFLPQTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLVPMVATV-OH
<p>Peptide H-NLVPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Suc-Ala-Ala-Pro-Phe-pNA
CAS:<p>N-Succinyl-L-alanyl-L-alanyl-L-prolyl-L-phenylalanine 4-nitroanilide is a colorimetric substrate for peptidyl-prolyl isomerase, chymotrypsin and human leukocyte cathepsin G but not reactive with elastase.</p>Formula:C30H36N6O9Purity:Min. 95%Color and Shape:PowderMolecular weight:624.64 g/molH-VRFPNITNL-OH
<p>Peptide H-VRFPNITNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSFISEGEIK-OH
<p>Peptide H-LSFISEGEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NWRAMASDFNLPPVV-OH
<p>Peptide H-NWRAMASDFNLPPVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEAPSLRPAPPPISGGGYR-OH
<p>Peptide H-EEAPSLRPAPPPISGGGYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYEQLLSRL-OH
<p>Peptide H-AYEQLLSRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RSV-B recombinant Nucleoprotein
<p>Please enquire for more information about RSV-B recombinant Nucleoprotein including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>
