Biochemicals and Reagents

<p>ELISA kit for detection of MIF in the research laboratory</p>

<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>ELISA kit for the detection of PR3  in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>ELISA kit for detection of Cystatin C in the research laboratory</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>ELISA kit for detection of Human IL6 in the research laboratory</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>Quantify total bovine IgM in your samples.</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>ELISA kit for detection of P-Selectin in the research laboratory</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>

<p>Horse SAA ELISA Kit</p>

<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>

<p>ELISA kit for detection of CD40 in the research laboratory</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Dog Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.</p>

<p>Mouse Fibronectin ELISA Kit</p>

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>Bovine SAA ELISA Kit</p>

<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse Retinol Binding Protein ELISA Kit</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>ELISA kit for detection of RBP4 in the research laboratory</p>

<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgM in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>PQR626 is a human analog of astaxanthin, a carotenoid with strong antioxidant properties. It has been shown to have anti-cancer effects by inhibiting the activity of trypsin-like proteases and kinases involved in tumor cell growth and survival. PQR626 induces apoptosis in cancer cells and has been investigated as a potential treatment for various types of cancer, including Chinese hamster ovary cells and prostate cancer. This compound also shows promise as an inhibitor of rifampicin-induced urinary excretion, which may increase the bioavailability of other drugs.</p>

<p>Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. NGAL binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients with urinary tract infections. Additionally, NGAL has been shown to be associated with neurological diseases, such as Alzheimer's disease and Parkinson's disease. The recombinant human form of this protein can be used for research purposes or for the development of diagnostic tools. Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. It binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients</p>

<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>

<p>Horse IgA ELISA Kit</p>

<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>Mouse Transferrin ELISA Kit</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>

<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Osteopontin ELISA Kit</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human Lambda ELISA Kit</p>

<p>Dog C3 ELISA Kit</p>

<p>Horse CRP ELISA Kit</p>

<p>D-Threonic acid lithium salt is a cell signaling molecule that belongs to the class of ligands. It has been used as a research tool in pharmacology and protein interaction studies. D-Threonic acid lithium salt can activate ion channels, which are cellular membrane proteins that allow ions to flow in or out of cells. D-Threonic acid lithium salt also interacts with receptors, which are proteins on the surface of cells that receive chemical signals from outside the cells. Receptors can be either agonists or antagonists. D-Threonic acid lithium salt is a ligand for receptor tyrosine kinase, which is involved in cell growth and differentiation.</p>

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for the detection of Triiodothyronine Uptake in the research laboratory</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>Mouse Cystatin C ELISA Kit</p>

<p>ELISA kit for the detection of MCP1 in the research laboratory</p>

<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>

<p>A reliable ELISA Kit for quantifying soluble interleukin-2 receptor (sIL-2R, sIL2R, sTAC, sCD25) in dog serum/plasma samples.</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>ELISA kit for detection of Human IL8 in the research laboratory</p>

<p>ELISA kit for detection of IGFBP1 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>

<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>

<p>For the quantitative determination of chicken immunoglobulin M (IgM) in biological samples.;</p>

<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Rat IgM ELISA Kit</p>

<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>

<p>Goat anti Human IgE antibody</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Human Kappa ELISA Kit</p>

<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Arabidopsis Thaliana Plant Lysate</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>Please enquire for more information about Fumaric acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>Bovine Lactoferrin ELISA Kit</p>

<p>ELISA kit for detection of Rubella in the research laboratory</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>

<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>ELISA kit for detection of Human IL4 in the research laboratory</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>ELISA Kit for detection of AVP in the research laboratory</p>

<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>

<p>ELISA Kit for detection of CEA in the research laboratory</p>

<p>Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.</p>

<p>ELISA Kit for detection of MDC in the research laboratory</p>

<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>

<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>ELISA Kit for detection of Estradiol antibody in the research laboratory</p>

<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>

<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>

<p>ELISA kit for the detection of Rat CRP in the research laboratory</p>

<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>

<p>ELISA Kit for detection of leukotriene E4 in the research laboratory</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>ELISA kit for detection of Thyroxine in the research laboratory</p>

<p>ELISA Kit for detection of Leukotriene B4 in the research laboratory</p>

<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hamster (CHO) Annexin A5 ELISA Kit<br> <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>

<p>Horse IgM ELISA Kit</p>

<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pig Fibrinogen ELISA Kit</p>

<p>Please enquire for more information about Human Retinol Binding Protein ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat NGAL ELISA Kit</p>

<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>

<p>ELISA Kit for detection of TARC in the research laboratory</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of IL18 in the research laboratory</p>

<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>ELISA Kit for detection of VEGF in the research laboratory</p>

<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>

<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>

<p>Rat Hemopexin ELISA Kit</p>

<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human KLK2(Kallikrein-2) ELISA Kit</p>

<p>ELISA kit for the detection of CA 15-3 in the research laboratory</p>

<p>ELISA Kit for detection of TPO in the research laboratory</p>

<p>2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine is a human analog that has been found to have anticancer properties. It acts as an inhibitor of kinases, which are enzymes involved in the regulation of cell growth and division. This compound induces apoptosis in Chinese hamster ovary cells and inhibits tumor growth in mice. 2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine has medicinal potential as a cancer therapy due to its ability to inhibit protein kinases that are involved in the development of cancer cells. This compound may be used as a therapeutic agent for various types of cancer, especially those that are resistant to conventional chemotherapy. It has also been detected in human urine, indicating its potential for use as a diagnostic tool for cancer.</p>

<p>ELISA kit for detection of EGF in the research laboratory</p>

<p>ELISA Kit for detection of Estradiol in the research laboratory</p>

<p>ELISA kit for detection of OPN in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>