Biochemicals and Reagents

<p>Rabbit polyclonal PTTG1IP antibody</p>

<p>Mouse monoclonal CD90.1 antibody (PE)</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>PARP6 antibody was raised in rabbit using the N terminal of PARP6 as the immunogen</p>

<p>ALDH1A1 antibody was raised in Mouse using a purified recombinant fragment of human ALDH1A1 expressed in E. coli as the immunogen.</p>

<p>Purified recombinant RPL35A protein (His tag)</p>

<p>The Methcathinone antibody is a highly effective neutralizing agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target autoantibodies. This antibody has shown remarkable efficacy in inhibiting the activity of acidic molecules such as β-catenin and TGF-beta1 (also known as TGF-β1). Additionally, it has been proven effective in blocking the action of trastuzumab, fibronectin, collagen, and alpha-fetoprotein. The Methcathinone antibody is widely recognized for its exceptional binding affinity and specificity towards TGF-beta, making it an invaluable tool in protein research and therapeutic applications.</p>

<p>Salmeterol Conjugate for use in immunoassays</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>MESP1 antibody was raised in rabbit using the N terminal of MESP1 as the immunogen</p>

<p>LGI1 antibody was raised in Rabbit using Human LGI1 as the immunogen</p>

<p>FAM84A antibody was raised using the N terminal of FAM84A corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD</p>

<p>Rat monoclonal LPAM1 antibody (allophycocyanin)</p>

<p>The PKR antibody is a monoclonal antibody that targets the protein kinase R (PKR), an enzyme involved in cellular responses to stress and viral infection. This antibody specifically binds to PKR, preventing its activation and inhibiting its downstream signaling pathways. The PKR antibody has been widely used in Life Sciences research, particularly in studies related to epidermal growth factor (EGF) signaling and cancer biology. It has also been used as a family kinase inhibitor in various experimental settings. The PKR antibody can be utilized for applications such as Western blotting, immunoprecipitation, and immunofluorescence. With its high specificity and affinity, this antibody is a valuable tool for researchers studying the role of PKR in cellular processes and disease development.</p>

<p>The PLK1 antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It specifically targets and binds to the PLK1 protein, which is primarily found in the nucleus of cells. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting PLK1 expression levels.</p>

<p>ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI</p>

<p>Rabbit polyclonal Transferrin antibody (FITC)</p>

<p>SB 258719 is a selective 5-HT1A receptor antagonist, which is a type of pharmacological agent that binds to and inhibits the activity of the 5-HT1A receptor. It is synthesized from chemical compounds typically used in neurobiological research. The mode of action involves the competitive blockade of serotonin (5-HT) at the 5-HT1A receptor sites, thereby preventing serotonin from activating these receptors in the brain.</p>

<p>Purified Polyclonal FSBP antibody</p>

<p>HAV VP3 antibody is a monoclonal antibody that specifically targets the HAV VP3 protein. It is commonly used in life sciences research to study the role of this protein in various biological processes. This antibody has been shown to bind to actin filaments, nuclear proteins, and albumin, making it a versatile tool for studying protein interactions and localization. Additionally, HAV VP3 antibody has been used in studies involving atypical hemolytic uremic syndrome and Brucella abortus infection. With its high specificity and affinity, this monoclonal antibody is a valuable asset for researchers in the field of immunology and molecular biology.</p>

<p>Purified recombinant p15 Treponema pallidum protein</p>

<p>Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS</p>

<p>PTPN2 antibody was raised using the middle region of PTPN2 corresponding to a region with amino acids ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN</p>

<p>The RIPK2 antibody is a highly specialized monoclonal antibody that targets the protein complex involved in various cellular processes, including growth factor signaling and transferrin metabolism. This antibody specifically recognizes RIPK2, a nuclear receptor that plays a crucial role in the regulation of biomolecules such as mineralocorticoid receptors. The RIPK2 antibody can be used for research purposes to study the function and localization of RIPK2 in different cell types.</p>

<p>Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.</p>

<p>gAcrp30 antibody was raised in goat using highly pure recombinant human gAcrp30/adipolean as the immunogen.</p>

<p>Mouse monoclonal TNF beta antibody (allophycocyanin)</p>

<p>Purified Rabbit polyclonal ERF antibody</p>

<p>Mouse monoclonal GKAP antibody</p>

<p>The CREB antibody is a highly specialized monoclonal antibody that is designed to target and bind to the CREB protein. It is commonly used in research laboratories and medical settings for its ability to detect and measure levels of CREB in various biological samples. The antibody is produced using advanced techniques, including hybridization of human hepatocytes with chimeric proteins and subsequent purification steps. It is conjugated with bovine γ-globulin for enhanced stability and reliability.</p>

<p>The hnRNP A1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets hnRNP A1, a protein involved in various cellular processes including RNA metabolism and splicing. This antibody is commonly used in assays to study the function and localization of hnRNP A1 in different cell types and tissues. Additionally, it has been shown to have potential therapeutic applications in antiestrogen therapy, as it can inhibit the growth factor signaling pathway mediated by hnRNP A1. The hnRNP A1 antibody is highly specific and has been extensively validated for its performance in various experimental settings. With its ability to detect and quantify hnRNP A1 levels, this antibody is an essential tool for researchers studying adipose biology, fatty acid metabolism, and protein kinase signaling pathways.</p>

<p>Rabbit polyclonal SAR1A antibody</p>

<p>MIER1 antibody was raised in Rabbit using Human MIER1 as the immunogen</p>

<p>The ARAF antibody is a peptide receptor that is widely used in Life Sciences. It is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers. This antibody specifically targets the ARAF protein, which plays a crucial role in various cellular processes. The ARAF antibody can be used as a diagnostic reagent to detect the expression of ARAF in different cell types or tissues. Additionally, it has been shown to be effective in studying tumor-related macrophages and their interactions with hematopoietic cells. The ARAF antibody is also useful for studying the extracellular environment and its impact on cellular behavior. Whether you are conducting research in cancer biology, immunology, or other fields, the ARAF antibody is an essential tool for investigating cellular signaling pathways and understanding disease mechanisms.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEDD4L antibody, catalog no. 70R-2633</p>

<p>The BAG2 antibody is a highly specialized monoclonal antibody that targets specific antigens in the field of Life Sciences. This antibody specifically recognizes lysine residues on its target antigen, allowing for precise and accurate detection. The BAG2 antibody has been extensively studied for its ability to inhibit syncytia formation, a process involved in cell fusion. Additionally, this antibody has shown promising results as an inhibitor of growth factors and non-phosphorylated proteins. With its unique properties, the BAG2 antibody is a valuable tool for researchers studying various cellular processes, including the nuclear localization of β-catenin.</p>

<p>Serotonin receptor 3C antibody was raised using a synthetic peptide corresponding to a region with amino acids CCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKT</p>

<p>Rat monoclonal CD122 antibody (biotin)</p>

<p>SETBP1 antibody was raised in rabbit using the middle region of SETBP1 as the immunogen</p>

<p>CXCR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Rotavirus SA11 protein is a native protein that plays a crucial role in the antigen-antibody reaction. It has been widely used in research and diagnostic applications for its natriuretic properties. The Rotavirus SA11 protein can be utilized in various assays such as hybridization, phosphatase labeling, and neutralizing antibody assays. Additionally, it has shown potential therapeutic benefits in the treatment of conditions related to dopamine dysregulation and autoantibodies. This protein is also being explored for its ability to inhibit the growth factor and anti-beta amyloid activities. With its versatility and diverse applications, the Rotavirus SA11 protein is an essential component for researchers and scientists working in the field of Proteins and Antigens.</p>

<p>Rabbit polyclonal SF3A1 antibody</p>

<p>BSA conjugated Sulfamethoxazole Hapten</p>

<p>HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL</p>

<p>The p38 MAPK antibody is a highly effective tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the activity of p38 MAPK, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>The Perforin antibody is a monoclonal antibody that acts as an immunosuppressant in the field of Life Sciences. It specifically targets and neutralizes perforin, a protein involved in immune cell function. This antibody has been extensively studied and proven effective in inhibiting the activity of perforin, which plays a crucial role in cell-mediated cytotoxicity. By blocking perforin, this antibody helps regulate immune responses and has potential applications in various research areas such as cancer, autoimmune diseases, and transplantation. With its high specificity and potency, the Perforin antibody is a valuable tool for scientists studying immune system regulation and related pathways.</p>

<p>Rabbit polyclonal RPL30 antibody</p>

<p>JAKMIP2 antibody was raised in Rabbit using Human JAKMIP2 as the immunogen</p>

<p>SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL</p>

<p>The PLK1 antibody is a cyclic peptide that is widely used in Life Sciences research. It has a low pH and is able to penetrate cell membranes, making it an effective tool for studying protein kinase activity. This antibody has a stimulatory effect on cellular processes and can be used to investigate the role of specific proteins in various biological pathways.</p>

<p>Recombinant Human ACP2 protein (His tag)</p>

<p>Abcb10 antibody was raised in rabbit using the middle region of Abcb10 as the immunogen</p>

<p>MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK</p>

<p>Mouse Tie2 immunogen; rat monoclonal Tie2 antibody (PE)</p>

<p>Rabbit polyclonal RABGGTA antibody</p>

<p>Rabbit polyclonal PLD3 antibody</p>

<p>Sheep polyclonal 4 Nitrophenyl AHD antibody</p>

<p>EDAR antibody is a cytotoxic monoclonal antibody that targets the EDAR protein. It contains disulfide bonds and has been shown to inhibit the binding of c-myc to its target DNA sequence. This antibody can be used for hybridization studies, as well as in vitro and in vivo experiments to investigate the role of EDAR in various biological processes. The EDAR antibody has been used as an inhibitor in studies investigating the function of EDAR signaling pathways. It has also been used in combination with other antibodies or drugs, such as ketamine, to enhance its cytotoxic effects. This monoclonal antibody specifically binds to the extracellular domain of EDAR and has been used as a tool in life sciences research to study the function and regulation of this protein.</p>

<p>Rat macrophage antibody was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Diphtheria toxin antibody was raised in mouse using the A subunit (free &amp; bound) of diphtheria toxin as the immunogen.</p>

<p>RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL</p>

<p>GPR27 antibody was raised using the N terminal of GPR27 corresponding to a region with amino acids MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLH</p>

<p>The PFKP antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to the PFKP protein, which plays a crucial role in regulating glucose metabolism. This antibody is produced through advanced techniques that ensure high specificity and purity.</p>

<p>The PML antibody is a monoclonal antibody that specifically targets the protein known as promyelocytic leukemia (PML). It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. The PML antibody binds to PML, inhibiting its activity and preventing its interaction with other proteins. This antibody has been shown to have neutralizing effects on PML function, making it a valuable tool for studying the role of PML in various cellular processes. Additionally, the PML antibody has been conjugated with different tags such as fluorescein isothiocyanate (FITC) or horseradish peroxidase (HRP), allowing for easy detection and visualization of PML in cells and tissues. With its high specificity and affinity, the PML antibody provides researchers with a reliable tool for investigating the function of PML and its potential involvement in disease processes.</p>

<p>Purified recombinant BSND protein (His tag)</p>

<p>NFATc2 antibody was raised in rabbit using residues 269-281 [ASPQRSRSPSPQP] of the human NFATc2 protein as the immunogen.</p>

<p>The Ferritin light chain antibody is a monoclonal antibody that targets the ferritin light chain protein. This antibody has been shown to have various characteristics and functions, including its ability to modulate vasoactive intestinal peptide (VIP) and growth factor signaling pathways. Additionally, it has been found to interact with dopamine and regulate copper concentrations in cells.</p>

<p>The LCK antibody is a highly specialized antibody used in Life Sciences research. It belongs to the group of Monoclonal Antibodies and is known for its cytotoxic and neutralizing properties. The LCK antibody specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>Norbuprenorphine 3 Conjugate for use in immunoassays</p>

<p>Rabbit Polyclonal KRCC1 antibody</p>

<p>HIV1 gp41 antibody was raised in goat using recombinant ectodomain of gp41 as the immunogen.</p>

<p>TSH antibody was raised in mouse using huma pituitary TSH as the immunogen.</p>

<p>Purified native Human Lactate Dehydrogenase 2 protein</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>Purified Polyclonal LSM2 antibody</p>

<p>Mouse monoclonal MAP2K4 antibody</p>

<p>The SERPINE1 antibody is a highly specialized antibody that targets the glutamate receptor. It belongs to the class of polyclonal antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also inhibits the activity of colony-stimulating factors, which are important for immune response regulation. The SERPINE1 antibody has been shown to be reactive against various monoclonal antibodies, making it a versatile tool for research purposes. Additionally, it exhibits cytotoxic effects on pluripotent cells and can inhibit the activity of protein kinases, including oncogenic kinases. This monoclonal antibody is non-phosphorylated, ensuring its stability and effectiveness in experimental settings. With its wide range of applications in molecular biology and immunology research, the SERPINE1 antibody is an invaluable tool for scientists seeking to unravel complex cellular mechanisms.</p>

<p>Rabbit polyclonal RIMS3 antibody</p>

<p>ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>Rabbit polyclonal PPAR gamma antibody (Ser112)</p>

<p>Rabbit polyclonal SPHK1 antibody</p>

<p>Purified recombinant JAM3 protein (His tag)</p>

<p>Rabbit polyclonal COL4A1 antibody (HRP)</p>

<p>Mouse monoclonal Myosin antibody</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>The Keratin 18 antibody is a nanocomposite that consists of a DNA aptamer with an amino group. It can be used in Life Sciences research to study the growth factor and protein kinases involved in various cellular processes. The antibody specifically targets Keratin 18, which is a protein expressed in epithelial cells. This monoclonal antibody allows for the detection and visualization of Keratin 18 through an antigen-antibody reaction. It can be used in applications such as immunofluorescence staining, western blotting, and polymerase chain reactions (PCR). The Keratin 18 antibody is highly specific and sensitive, making it a valuable tool for researchers studying cellular biology and disease mechanisms.</p>

<p>Rabbit polyclonal GPR92 antibody</p>

<p>Purified Polyclonal MYST4 antibody</p>

<p>FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Haptoglobin antibody was raised against Human Haptoglobin.</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Purified recombinant HOXC11 protein (His tag)</p>

<p>Rabbit polyclonal Caspase 1 antibody (FITC)</p>

<p>Mouse monoclonal OMP28 antibody</p>

<p>Sheep polyclonal Sulphanitran antibody</p>