Biochemicals and Reagents

<p>Rat monoclonal CD122 antibody (biotin)</p>

<p>SETBP1 antibody was raised in rabbit using the middle region of SETBP1 as the immunogen</p>

<p>CXCR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Rotavirus SA11 protein is a native protein that plays a crucial role in the antigen-antibody reaction. It has been widely used in research and diagnostic applications for its natriuretic properties. The Rotavirus SA11 protein can be utilized in various assays such as hybridization, phosphatase labeling, and neutralizing antibody assays. Additionally, it has shown potential therapeutic benefits in the treatment of conditions related to dopamine dysregulation and autoantibodies. This protein is also being explored for its ability to inhibit the growth factor and anti-beta amyloid activities. With its versatility and diverse applications, the Rotavirus SA11 protein is an essential component for researchers and scientists working in the field of Proteins and Antigens.</p>

<p>Rabbit polyclonal SF3A1 antibody</p>

<p>BSA conjugated Sulfamethoxazole Hapten</p>

<p>HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL</p>

<p>The p38 MAPK antibody is a highly effective tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the activity of p38 MAPK, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>The Perforin antibody is a monoclonal antibody that acts as an immunosuppressant in the field of Life Sciences. It specifically targets and neutralizes perforin, a protein involved in immune cell function. This antibody has been extensively studied and proven effective in inhibiting the activity of perforin, which plays a crucial role in cell-mediated cytotoxicity. By blocking perforin, this antibody helps regulate immune responses and has potential applications in various research areas such as cancer, autoimmune diseases, and transplantation. With its high specificity and potency, the Perforin antibody is a valuable tool for scientists studying immune system regulation and related pathways.</p>

<p>Rabbit polyclonal RPL30 antibody</p>

<p>JAKMIP2 antibody was raised in Rabbit using Human JAKMIP2 as the immunogen</p>

<p>SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL</p>

<p>The PLK1 antibody is a cyclic peptide that is widely used in Life Sciences research. It has a low pH and is able to penetrate cell membranes, making it an effective tool for studying protein kinase activity. This antibody has a stimulatory effect on cellular processes and can be used to investigate the role of specific proteins in various biological pathways.</p>

<p>Recombinant Human ACP2 protein (His tag)</p>

<p>Abcb10 antibody was raised in rabbit using the middle region of Abcb10 as the immunogen</p>

<p>MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK</p>

<p>Mouse Tie2 immunogen; rat monoclonal Tie2 antibody (PE)</p>

<p>Rabbit polyclonal RABGGTA antibody</p>

<p>Rabbit polyclonal PLD3 antibody</p>

<p>Sheep polyclonal 4 Nitrophenyl AHD antibody</p>

<p>EDAR antibody is a cytotoxic monoclonal antibody that targets the EDAR protein. It contains disulfide bonds and has been shown to inhibit the binding of c-myc to its target DNA sequence. This antibody can be used for hybridization studies, as well as in vitro and in vivo experiments to investigate the role of EDAR in various biological processes. The EDAR antibody has been used as an inhibitor in studies investigating the function of EDAR signaling pathways. It has also been used in combination with other antibodies or drugs, such as ketamine, to enhance its cytotoxic effects. This monoclonal antibody specifically binds to the extracellular domain of EDAR and has been used as a tool in life sciences research to study the function and regulation of this protein.</p>

<p>Rat macrophage antibody was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Diphtheria toxin antibody was raised in mouse using the A subunit (free &amp; bound) of diphtheria toxin as the immunogen.</p>

<p>RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL</p>

<p>GPR27 antibody was raised using the N terminal of GPR27 corresponding to a region with amino acids MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLH</p>

<p>The PFKP antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to the PFKP protein, which plays a crucial role in regulating glucose metabolism. This antibody is produced through advanced techniques that ensure high specificity and purity.</p>

<p>The PML antibody is a monoclonal antibody that specifically targets the protein known as promyelocytic leukemia (PML). It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. The PML antibody binds to PML, inhibiting its activity and preventing its interaction with other proteins. This antibody has been shown to have neutralizing effects on PML function, making it a valuable tool for studying the role of PML in various cellular processes. Additionally, the PML antibody has been conjugated with different tags such as fluorescein isothiocyanate (FITC) or horseradish peroxidase (HRP), allowing for easy detection and visualization of PML in cells and tissues. With its high specificity and affinity, the PML antibody provides researchers with a reliable tool for investigating the function of PML and its potential involvement in disease processes.</p>

<p>Purified recombinant BSND protein (His tag)</p>

<p>NFATc2 antibody was raised in rabbit using residues 269-281 [ASPQRSRSPSPQP] of the human NFATc2 protein as the immunogen.</p>

<p>The Ferritin light chain antibody is a monoclonal antibody that targets the ferritin light chain protein. This antibody has been shown to have various characteristics and functions, including its ability to modulate vasoactive intestinal peptide (VIP) and growth factor signaling pathways. Additionally, it has been found to interact with dopamine and regulate copper concentrations in cells.</p>

<p>The LCK antibody is a highly specialized antibody used in Life Sciences research. It belongs to the group of Monoclonal Antibodies and is known for its cytotoxic and neutralizing properties. The LCK antibody specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>Norbuprenorphine 3 Conjugate for use in immunoassays</p>

<p>Rabbit Polyclonal KRCC1 antibody</p>

<p>HIV1 gp41 antibody was raised in goat using recombinant ectodomain of gp41 as the immunogen.</p>

<p>TSH antibody was raised in mouse using huma pituitary TSH as the immunogen.</p>

<p>Purified native Human Lactate Dehydrogenase 2 protein</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>Purified Polyclonal LSM2 antibody</p>

<p>LDHB antibody was raised in Rabbit using Human LDHB as the immunogen</p>

<p>Recombinant PPAP protein</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>Vaspin antibody was raised in mouse using recombinant human Vaspin (21-414aa) purified from E. coli as the immunogen.</p>

<p>Purified recombinant UGT8 protein (His tag)</p>

<p>VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN</p>

<p>Recombinant human IL-6</p>

<p>The Nuclear Pore Complex antibody is a highly specific monoclonal antibody designed for use in Life Sciences research. It is used to detect and study the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. This antibody binds specifically to proteins within the nuclear pore complex, allowing researchers to visualize and study its function.</p>

<p>Rabbit polyclonal TSPAN7 antibody</p>

<p>YARS antibody was raised in mouse using recombinant Tyrosyl-Trna Synthetase (Yars)</p>

<p>TSH beta protein is a native protein that belongs to the group of proteins and antigens. It is commonly used in life sciences research, particularly in studies related to colony-stimulating factors. TSH beta protein has been shown to have various functions, including the regulation of metabolism and growth. It can interact with other molecules such as flavobacterium, glucagon, monoclonal antibodies, and inhibitors. Additionally, TSH beta protein has been found to play a role in adipose tissue function and the production of growth factors like GM-CSF (granulocyte-macrophage colony-stimulating factor). Researchers often utilize TSH beta protein in experiments involving electrodes and anti-MERTK antibodies due to its unique properties and interactions.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>PAFAH1B3 antibody was raised using the middle region of PAFAH1B3 corresponding to a region with amino acids GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN</p>

<p>Purified Rabbit polyclonal LYAR antibody</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN</p>

<p>The CD2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It interacts with CD2, a cell surface glycoprotein expressed on T cells, natural killer cells, and thymocytes. This antibody has been extensively studied for its potential applications in various areas of research.</p>

<p>Rabbit polyclonal CTCFL antibody</p>

<p>C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI</p>

<p>PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains, leading to cell growth inhibition in culture.</p>

<p>SLC39A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS</p>

<p>INSR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MAGEH1 antibody was raised in Rabbit using Human MAGEH1 as the immunogen</p>

<p>Mouse monoclonal TBX2 antibody</p>

<p>The ALDH3A1 antibody is a powerful tool in the field of antiviral research. It belongs to the class of Monoclonal Antibodies, which are highly specific and effective in targeting specific antigens. This antibody has been extensively studied for its ability to neutralize autoantibodies and antibodies that can cause autoimmune diseases. It has also shown promising results in combination with gemcitabine treatment, enhancing the effectiveness of this chemotherapy drug.</p>

<p>Rabbit polyclonal SLC9A8 antibody</p>

<p>Rabbit polyclonal GK3P antibody</p>

<p>HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET</p>

<p>Rabbit Polyclonal DUSP16 antibody</p>

<p>LRRC4C antibody was raised in Rabbit using Human LRRC4C as the immunogen</p>

<p>The MCL1 antibody is a monoclonal antibody used in Life Sciences. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α), which is involved in inflammation and cell death. This antibody can also target molecules such as insulin and growth factors, making it a valuable tool in research and therapeutic applications. Additionally, the MCL1 antibody can be used to detect specific proteins, including rubisco, and can be utilized in various immunoassays. With its specificity and versatility, this monoclonal antibody is a valuable asset for scientists and researchers in the field of Life Sciences.</p>

<p>Purified Rabbit polyclonal NFKBID antibody</p>

<p>Pig Plasma is a high-quality biospecimen that is commonly used in various research and veterinary applications. It contains a wide range of important components, including chemokines, antibodies, interferons, and glycoproteins. Pig Plasma also contains neutralizing agents that can inhibit the activity of harmful pathogens. This product is particularly useful for studying the antiviral properties of certain substances or developing new therapeutic interventions. Additionally, Pig Plasma can be utilized in liver microsome studies to assess drug metabolism and evaluate potential drug-drug interactions. With its diverse array of components and versatile applications, Pig Plasma is an essential resource for researchers and veterinarians alike.</p>

<p>Mouse monoclonal PRKAR1B antibody</p>

<p>Purified Rabbit polyclonal p53 antibody (Ser20)</p>

<p>MARCKS antibody is a neutralizing peptide agent that targets interleukin-6 (IL-6), an important cytokine involved in immune responses. It acts as an anticoagulant by inhibiting the activation of coagulation factors. The monoclonal antibody specifically binds to MARCKS, a protein involved in cell signaling and cytoskeletal regulation. By blocking the interaction between MARCKS and its binding proteins, the antibody disrupts cellular processes such as cell adhesion, migration, and proliferation. Additionally, it has been shown to inhibit the binding of fibrinogen and colony-stimulating factor (M-CSF) to their respective receptors, further modulating cellular responses. This antibody is glycosylated, meaning it has attached glycans or glycopeptides that can affect its stability and activity. Its activated form has been extensively studied for its potential therapeutic applications in autoimmune diseases and cancer.</p>

<p>LDHC antibody was raised in Rabbit using Human LDHC as the immunogen</p>

<p>Recombinant Human THOC7 protein (His tag)</p>

<p>Rabbit polyclonal RXRC antibody</p>

<p>CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME</p>

<p>FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)</p>

<p>Rat monoclonal TRANCE antibody (biotin)</p>

<p>Rabbit polyclonal BTBD2 antibody (FITC)</p>

<p>Rabbit polyclonal Troponin I antibody (Ser43)</p>

<p>Purified Rabbit polyclonal IGF2R antibody (Ser2409)</p>

<p>Rat monoclonal Ly6A/E antibody (biotin)</p>

<p>Rabbit polyclonal VPS24 antibody</p>

<p>EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS</p>

<p>ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA</p>

<p>The CDCP1 antibody is a monoclonal antibody that specifically targets the surface glycoprotein known as CDCP1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various phenotypic assays. The CDCP1 antibody has demonstrated its ability to inhibit epidermal growth factor-induced cell proliferation and migration, making it a potential therapeutic agent for diseases related to abnormal cell growth. Additionally, this antibody has been used as a diagnostic agent for the detection of CDCP1 expression in cancer cells. Its high specificity and affinity make it an ideal tool for identifying and studying CDCP1-expressing cells. The use of monoclonal antibodies like the CDCP1 antibody has revolutionized the field of molecular targeting and continues to contribute to advancements in research and medicine.</p>

<p>The PLD4 antibody is a valuable tool in the field of Life Sciences. It plays a crucial role in various biological processes, including calpain activation, fibronectin matrix assembly, and endothelial cell growth. This medicament is an adeno-associated virus (AAV) vector-based Polyclonal Antibody that specifically targets PLD4. The antibody binds to PLD4 and inhibits its activity, leading to a decrease in collagen production and angiogenesis.</p>

<p>The Hexokinase 1 antibody is a powerful tool used in Life Sciences research. It is an antibody specifically designed to target and bind to Hexokinase 1, an enzyme involved in glucose metabolism. This antibody has been shown to be highly effective in various applications, including the study of fatty acid metabolism, insulin-like growth factor signaling, and the role of Hexokinase 1 in diseases such as cancer.</p>

<p>AVIL antibody was raised in Rabbit using Human AVIL as the immunogen</p>

<p>Mouse Monoclonal FUBP1 antibody</p>

<p>LAPTM4A antibody was raised using the middle region of LAPTM4A corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA</p>

<p>Purified recombinant RAET1E protein</p>

<p>NEI3 antibody was raised in rabbit using residues 164-177 (LRAESEVKKQKGRMLG) of the human NEI3 protein as the immunogen.</p>