Biochemicals and Reagents

<p>ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE</p>

<p>1-495 amino acids: MGSSHHHHHH SSGLVPRGSH MPQLLQNING IIEAFRRYAR TEGNCTALTR GELKRLLEQE FADVIVKPHD PATVDEVLRL LDEDHTGTVE FKEFLVLVFK VAQACFKTLS ESAEGACGSQ ESGSLHSGAS QELGEGQRSG TEVGRAGKGQ HYEGSSHRQS QQGSRGQNRP GVQTQGQATG SAWVSSYDRQ AESQSQERIS PQIQLSGQTE QTQKAGEGKR NQTTEMRPER QPQTREQDRA HQTGETVTGS GTQTQAGATQ TVEQDSSHQT GRTSKQTQEA TNDQNRGTET HGQGRSQTSQ AVTGGHAQIQ AGTHTQTPTQ TVEQDSSHQT GSTSTQTQES TNGQNRGTEI HGQGRSQTSQ AVTGGHTQIQ AGSHTETVEQ DRSQTVSHGG AREQGQTQTQ PGSGQRWMQV SNPEAGETVP GGQAQTGAST EPGRQEWSST HPRRCVTEGQ GDRQPTVVGE EWVDDHSRET VILRLDQGNL HTSVSSAQGQ DAAQSEEKRG ITARELYSYL RSTKP</p>

<p>Mouse monoclonal Ig kappa light chain antibody (FITC)</p>

<p>The PDCD4 antibody is a highly reactive and potent monoclonal antibody that targets the growth factor PDCD4. It is derived from a transgenic cell line and has been extensively tested for its specificity and efficacy. This antibody has shown great potential in various life sciences applications, including cancer research and therapy.</p>

<p>PRIM1 antibody was raised using the N terminal of PRIM1 corresponding to a region with amino acids SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM</p>

<p>TRAIL receptor 3 antibody was raised in rabbit using N terminus of the mature human TRAIL-R3 protein as the immunogen.</p>

<p>The ALF antibody is a neutralizing antibody that targets interferon in Life Sciences. It is a biomolecule that specifically binds to galectin-3, a glycoprotein involved in various biological processes. This monoclonal antibody has been extensively studied and proven to be effective in blocking the activity of galectin-3, making it a valuable tool for research and therapeutic applications. Additionally, the ALF antibody has shown promising results as a potential treatment for multidrug-resistant infections and as a therapeutic agent for diseases involving myelin-associated glycoprotein. With its high specificity and affinity, this monoclonal antibody offers great potential for advancing scientific understanding and developing innovative therapies in the field of Life Sciences.</p>

<p>Rabbit polyclonal Tyrosine Hydroxylase antibody (Ser31)</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>MMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN</p>

<p>Rat monoclonal IL28 antibody</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>Rabbit polyclonal OR10G2 antibody</p>

<p>Purified Polyclonal EMP antibody</p>

<p>The CYP2C9 antibody is a protein that plays a crucial role in drug metabolism. It is an enzyme involved in the breakdown of various medications, including alkaline phosphatases and glutamate. This antibody is widely used in Life Sciences research to study the interactions between drugs and enzymes.</p>

<p>Rat monoclonal 41BB Ligand antibody (biotin)</p>

<p>DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML</p>

<p>Purified Polyclonal MRPL21 antibody</p>

<p>Mouse monoclonal LAMB2 antibody</p>

<p>Salinomycin Conjugate for use in immunoassays</p>

<p>Calcitonin antibody was raised in mouse using calcitonin conjugated with carrier protein as the immunogen.</p>

<p>ITGA4 antibody was raised in Rabbit using Human ITGA4 as the immunogen</p>

<p>The Toll-like receptor 2 antibody is a powerful tool in Life Sciences research. It is a monoclonal antibody that specifically targets Toll-like receptor 2 (TLR2), an important component of the innate immune system. TLR2 plays a crucial role in recognizing and responding to microbial pathogens, making it an attractive target for therapeutic interventions.</p>

<p>High sensitivity TMB Substrate for use in high sensitivity immunoassays designed in 3D-IF format</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. The drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF488 antibody, catalog no. 70R-8442</p>

<p>CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface glycoprotein expressed on activated leukocytes. This antibody has antiangiogenic properties and can induce apoptosis in tumor cells by binding to the necrosis factor-related apoptosis-inducing ligand (TRAIL). CD11b antibody can be used in various applications, including immunoprecipitation, Western blotting, and flow cytometry. It has been shown to inhibit the adhesion of leukocytes to endothelial cells and block the migration of leukocytes into inflamed tissues. Additionally, CD11b antibody can be used for the detection of CD11b in nuclear extracts and human serum samples. Its high specificity and affinity make it a valuable tool in Life Sciences research and diagnostic applications.</p>

<p>TRIM23 antibody was raised in rabbit using the N terminal of TRIM23 as the immunogen</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>CD144 antibody is a monoclonal antibody that specifically targets CD144, also known as vascular endothelial cadherin (VE-cadherin). It plays a crucial role in maintaining the integrity and stability of endothelial cell-cell junctions. CD144 antibody can be used in various life science research applications, including the study of interleukin-6 signaling, influenza hemagglutinin binding assays, and the detection of reactive oxygen species.</p>

<p>Purified Polyclonal Alpha actin 1 antibody</p>

<p>The REDD1 antibody is a highly specialized product used in Life Sciences research. It is an immunogenic composition designed to target and detect the presence of REDD1 protein in various biological samples. The REDD1 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable tool for researchers studying the role of REDD1 in different cellular processes.</p>

<p>Mouse monoclonal TMED1 antibody</p>

<p>Rabbit polyclonal TIMM9 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>The CD160 antibody is a monoclonal antibody that targets the CD160 protein, which is involved in immune response regulation. It acts as a colony-stimulating factor and plays a role in the activation of macrophages. The CD160 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various experimental models. It has been shown to inhibit the activity of phosphatase enzymes and interfere with interferon signaling pathways. Additionally, it has been found to bind to glutamate receptors and modulate their function. The CD160 antibody is highly specific and exhibits strong binding affinity to its target. It can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. This high-quality antibody is suitable for research purposes and is compatible with human serum samples.</p>

<p>EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Tau antibody (Ser214)</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>The NGAL antibody is a powerful multidrug antibody that has been specifically designed to target and neutralize activated antibodies in the body. This unique antibody has shown great potential in the field of Life Sciences, particularly in the development of monoclonal antibodies for therapeutic purposes. The NGAL antibody has been found to inhibit the activity of necrosis factor-related apoptosis-inducing antibodies, which are known to play a critical role in various diseases.</p>

<p>The GPR75 antibody is a powerful tool used in the field of life sciences. It specifically targets glucagon, a hormone involved in regulating glucose levels in the body. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Attractin antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>EBF3 antibody was raised in rabbit using the middle region of EBF3 as the immunogen</p>

<p>Mouse monoclonal MHC Class I antibody (allophycocyanin)</p>

<p>Rabbit polyclonal Raf1 antibody (Ser259)</p>

<p>The ST3GAL4 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the ST3GAL4 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in applications such as immunohistochemistry, immunofluorescence, Western blotting, and flow cytometry.</p>

<p>The Alkaline Phosphatase antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the alkaline phosphatase enzyme, which plays a crucial role in various biological processes such as glycosylation, exocytosis, and nuclear signaling. This antibody binds to the active site of alkaline phosphatase and inhibits its activity, allowing researchers to study the effects of its inhibition on cellular functions.</p>

<p>HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR</p>

<p>Rabbit polyclonal HS71L antibody</p>

<p>Rabbit polyclonal THOC7 antibody</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC</p>

<p>16:0-16:0-d31 Pc is a synthetic peptide that is used as an inhibitor of 16:0-16:0 binding to the receptor. The peptide has been shown to bind to the ligand binding domain in the extracellular loop of the receptor and prevent it from activating the ion channels. This peptide is also used as a research tool for studying protein interactions, and can be used in pharmacology, life science, and cell biology.</p>

<p>The USP7 antibody is a monoclonal antibody that specifically binds to the receptor for colony-stimulating factor (CSF). This antibody has been shown to have cytotoxic effects on cells that express high levels of the CSF receptor, making it a promising therapeutic option in the field of life sciences. The USP7 antibody works by neutralizing the activity of CSF, which is a growth factor involved in cell proliferation and differentiation. By blocking the binding of CSF to its receptor, this antibody inhibits the downstream signaling pathways that promote cell growth and survival. Additionally, the USP7 antibody has been found to interact with calmodulin and form dimers, which further enhances its cytotoxic effects. With its ability to selectively target activated cells expressing high levels of the CSF receptor, this monoclonal antibody holds great potential for targeted therapy in various diseases.</p>

<p>The beta Actin antibody is a highly specific monoclonal antibody that targets the beta-actin protein. It is widely used in research and diagnostic applications to detect and quantify the expression levels of beta-actin in various samples, including human serum. This antibody has been proven to be cytotoxic towards cells expressing sclerostin, an antigen associated with bone disorders. The beta Actin antibody can be used in a variety of assays, including Western blotting, immunohistochemistry, and flow cytometry, to study the localization and function of beta-actin in different cellular contexts. Its high specificity and sensitivity make it an indispensable tool for researchers studying cellular processes such as cell motility, cytoskeletal dynamics, and intracellular signaling pathways involving beta-actin.</p>

<p>The Beta catenin antibody is a highly versatile antibody that plays a crucial role in various biological processes. It is commonly used in life sciences research, particularly in the field of pluripotent stem cells. This antibody specifically targets β-catenin, a protein that is involved in cell adhesion and signaling pathways.</p>

<p>CD45RO Monoclonal Antibody (HRP)</p>

<p>CACYBP antibody is a serum marker used in Life Sciences to detect the presence of dopamine. It is commonly used in research involving pluripotent stem cells. This antibody specifically targets CACYBP, a protein involved in various cellular processes. The CACYBP antibody can be used for chromatographic and immunological assays to study the activation and function of CACYBP. It can also be used as a diagnostic tool to detect autoantibodies associated with certain diseases. Additionally, this antibody can be used in the development of monoclonal antibodies or other therapeutic agents targeting CACYBP. Its application extends to studies involving methyl transferase activity, interferon-stimulated gene expression, acetylcholine signaling, and transmembrane conductance.</p>

<p>TAAR5 antibody was raised in rabbit using the C terminal of TAAR5 as the immunogen</p>

<p>Rabbit polyclonal SDP3 antibody (HRP)</p>

<p>EGFR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.</p>

<p>Rabbit Polyclonal GPT antibody (biotin)</p>

<p>Rabbit polyclonal SCN2B antibody</p>

<p>The MAP2K2 antibody is a highly effective monoclonal antibody that has neutralizing properties. It acts by targeting and inhibiting the activity of MAP2K2, a protein involved in cellular signaling pathways. This antibody is particularly useful in studies involving antibodies, autoantibodies, interferon, and colony-stimulating factors. It has been extensively tested on various cell lines, including MCF-7 cells, and has shown excellent results in blocking the activity of MAP2K2. Additionally, this antibody has been found to have inhibitory effects on antiphospholipid antibodies and other factors that contribute to disease progression. With its high specificity and potency, the MAP2K2 antibody is an invaluable tool for researchers studying signal transduction pathways and developing targeted therapies.</p>

<p>SLC25A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>H2AFY antibody was raised using the middle region of H2AFY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG</p>

<p>Mouse monoclonal CHEK2 antibody</p>

<p>ERK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal GPR157 antibody</p>

<p>Recombinant Human CCBL1 protein with His tag</p>

<p>The p300 antibody is a highly specialized antibody that is commonly used in the field of Life Sciences. It is an acidic, polyclonal antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied and shown to have neutralizing and inhibitory effects on certain factors, making it a valuable tool for researchers.</p>

<p>FAM3C antibody was raised using the C terminal of FAM3C corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD</p>

<p>ApoA1 protein is a versatile protein that plays a crucial role in various biological processes. It is a protein polymer that acts as a lipid synthesis inhibitor and is involved in the regulation of cholesterol metabolism. This protein has been extensively studied in the field of Life Sciences, where it has been identified as a potential biomarker for various diseases.</p>

<p>The SERPINB2 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to SERPINB2, an acidic protein found in human serum. This antibody has been shown to be highly effective in detecting and quantifying the levels of SERPINB2 in various biological samples.</p>

<p>Purified recombinant FSBP protein (His tag)</p>

<p>Mouse monoclonal MYL4 antibody</p>

<p>C1QTNF4 antibody was raised in Rabbit using Human C1QTNF4 as the immunogen</p>

<p>MAGEA11 antibody was raised in rabbit using the middle region of MAGEA11 as the immunogen</p>

<p>Purified Polyclonal AMD1 antibody</p>

<p>The EPHB3 antibody is a highly specialized cytotoxic agent that targets the EPHB3 receptor. This receptor plays a crucial role in cell signaling pathways, including phosphatase and TNF-related apoptosis-inducing ligand (TRAIL) pathways. By binding to the EPHB3 receptor, this antibody inhibits its activity, leading to decreased cell growth and survival.</p>

<p>IMP3 antibody was raised in Rabbit using Human IMP3 as the immunogen</p>

<p>Rabbit polyclonal DJ1 antibody (biotin)</p>

<p>Rabbit polyclonal SMC5 antibody</p>

<p>FH antibody is a monoclonal antibody that specifically targets nuclear β-catenin, which is involved in various cellular processes. This antibody can be used in bioassays to study the role of β-catenin in different biological systems. FH antibody has been shown to have inhibitory effects on steroid production and can be used as a tool for studying steroidogenesis. In addition, this antibody has potential applications in the field of life sciences for the development of therapeutic antibodies or inhibitors targeting specific proteins or pathways. FH antibody also shows binding affinity to collagen and plasticizers, making it useful for applications involving these materials. Furthermore, FH antibody has been studied for its potential use in treating choroidal neovascularization and androgen-related disorders.</p>

<p>C20ORF116 antibody was raised using the middle region of C20Orf116 corresponding to a region with amino acids EERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKL</p>

<p>Rabbit polyclonal ACTA1 antibody (FITC)</p>

<p>CDC45L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED</p>

<p>VZV protein is a key component in Life Sciences, specifically in the field of Proteins and Antigens. It plays a crucial role in various biological processes and has been extensively studied for its potential therapeutic applications. VZV protein has shown promising results in research involving ranolazine, where it was found to modulate the expression of messenger RNA (mRNA) associated with cardiac function. Additionally, VZV protein has been used for immobilization studies on electrodes, enabling ultrasensitive detection of dopamine and natriuretic peptides in human serum. Its neutralizing properties make it an ideal candidate for the development of monoclonal antibodies and DNA vaccines targeting specific pathogens. With its diverse range of applications, VZV protein continues to be at the forefront of cutting-edge research in the field of Life Sciences.</p>

<p>PHOSPHO2 antibody was raised in rabbit using the N terminal of PHOSPHO2 as the immunogen</p>

<p>5-Methyl cytosine antibody was raised in sheep using 5-methyl cytosine as the immunogen.</p>

<p>The UQCRC2 antibody is a potent antifibrotic agent that works by targeting and lysing specific cells involved in fibrosis. This monoclonal antibody has been extensively studied and validated using polymerase chain techniques, demonstrating its high specificity and efficacy. It has also been shown to effectively neutralize autoantibodies and inhibit the activation of mesenchymal stem cells, which play a crucial role in fibrotic processes. The UQCRC2 antibody specifically targets atypical hemolytic cells by binding to their surface receptors, leading to their destruction. Additionally, this antibody can be used for immunohistochemical detection of protein complexes, such as serine proteases or amyloid plaques, making it a valuable tool for research and diagnostic purposes. Available as both polyclonal and monoclonal antibodies, the UQCRC2 antibody offers a versatile solution for various applications in the field of immunology.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified recombinant KLK1 protein (His tag)</p>

<p>Rabbit polyclonal SLC25A11 antibody</p>

<p>Mouse PMN antibody was raised in rabbit using murine PMNs as the immunogen.</p>

<p>PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>JUNB antibody was raised in mouse using recombinant Human Jun B Proto-Oncogene</p>

<p>Rabbit polyclonal TCTN1 antibody</p>

<p>Mouse monoclonal Rubeola virus antibody</p>