Biochemicals and Reagents

<p>LENG1 antibody was raised in Rabbit using Human LENG1 as the immunogen</p>

<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG</p>

<p>ODF3L1 antibody was raised using the N terminal of ODF3L1 corresponding to a region with amino acids KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC</p>

<p>Rabbit polyclonal TTF2 antibody</p>

<p>MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR</p>

<p>Purified Polyclonal GPR12 antibody</p>

<p>Influenza B antibody (FITC) was raised in mouse using am Infuenze B nuclear protein as the immunogen.</p>

<p>PTDSR antibody was raised in rabbit using the middle region of PTDSR as the immunogen</p>

<p>Purified Polyclonal PKAC alpha/beta/gamma antibody</p>

<p>Morphine 3 Conjugate for use in immunoassays</p>

<p>The Akt2 antibody is a highly specialized monoclonal antibody that specifically targets the Akt2 protein. This cyclic peptide antibody has a unique structure with carboxy and amino groups that enable it to bind to the antigen binding domain of Akt2. It has been extensively tested in Life Sciences research and has shown remarkable specificity and affinity for its target.</p>

<p>TBG antibody was raised in mouse using purified human TBG as the immunogen.</p>

<p>Rabbit polyclonal ELOA1 antibody</p>

<p>Ectodysplasin A antibody was raised using the middle region of EDA corresponding to a region with amino acids HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY</p>

<p>Rabbit polyclonal Septin 6 antibody</p>

<p>Rabbit polyclonal Calcitonin antibody (Prediluted for IHC)</p>

<p>The CRKL antibody is a neutralizing monoclonal antibody used in Life Sciences research. It is designed to target and bind to the CRKL protein kinase, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>CCDC158 antibody was raised in Rabbit using Human CCDC158 as the immunogen</p>

<p>The OCT4 antibody is a highly specialized monoclonal antibody that targets the OCT4 protein. This protein plays a crucial role in stem cell pluripotency and is commonly used as a marker for identifying and isolating stem cells. The OCT4 antibody specifically binds to the OCT4 protein, allowing for its detection and analysis in various biological samples.</p>

<p>Purified recombinant Human DBNDD2 protein (His tag)</p>

<p>Purified Polyclonal Connexin 32 antibody</p>

<p>Rabbit polyclonal EIF3S2 antibody (biotin)</p>

<p>SLC38A1 antibody was raised using the middle region of SLC38A1 corresponding to a region with amino acids LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN</p>

<p>CK1 alpha 1 antibody was raised using the C terminal of CSNK1A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF</p>

<p>CCRD6 antibody was raised in goat using a synthetic peptide C-L10ATEDADSENSSFYYYDYLDEVAFM35L corresponding to the N-terminal extracellular domain of human D6 as the immunogen.</p>

<p>CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL</p>

<p>LDLRAD3 antibody is a polyclonal antibody that is commonly used in life sciences research. It is highly specific and sensitive, making it an ideal tool for various applications. This antibody can be used for immunohistochemistry, Western blotting, ELISA, and other assays to detect the presence of LDLRAD3 protein in samples. The antibody has been validated using sodium citrate-activated antigen retrieval and has shown excellent performance in detecting LDLRAD3 in various tissues. Additionally, this antibody can be used as a primary or secondary antibody when combined with other antibodies to study protein-protein interactions or signaling pathways. Its high affinity and specificity make it a valuable tool for researchers studying growth factors, protein kinases, nuclear proteins, and inhibitors. With its versatility and reliability, the LDLRAD3 antibody is an essential component of any laboratory involved in life sciences research.</p>

<p>Rabbit polyclonal TOM1L1 antibody</p>

<p>TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF</p>

<p>The MYL6 antibody is a highly specific monoclonal antibody that targets the human serum. It is commonly used in assays and as an inhibitor in various research studies. This antibody specifically binds to collagen and hyaluronic acid, making it an excellent tool for studying these molecules and their interactions. Additionally, the MYL6 antibody has been shown to have cytotoxic effects on adipose tissue, making it a potential candidate for therapeutic applications. It can also be used in the detection of autoantibodies and as a tool to study urokinase plasminogen activator (uPA) signaling pathways. Furthermore, the MYL6 antibody has shown promising results as an anti-ICOS antibody, which could be beneficial in treating conditions related to thrombocytopenia. With its versatility and specificity, the MYL6 antibody is an invaluable tool for researchers in various fields of study.</p>

<p>The ACY1 antibody is a highly specialized monoclonal antibody that has been developed for various applications. It has been shown to be effective in neutralizing the activity of mesenchymal stem cells, making it a valuable tool for research and therapeutic purposes. Additionally, this antibody has demonstrated its ability to target and bind to specific proteins such as anti-mesothelin, fibrinogen, influenza hemagglutinin, and alpha-fetoprotein. This makes it an essential component in diagnostic tests and assays targeting these proteins. The ACY1 antibody has also shown potential antiviral properties, making it a promising candidate for the development of antiviral therapies. Its high specificity and affinity make it an invaluable tool for researchers and clinicians alike in their efforts to understand and combat various diseases and conditions.</p>

<p>Lp-PLA2 monoclonal antibody is a highly specialized antibody used in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Lp-PLA2, an enzyme involved in the inflammation process. By binding to Lp-PLA2, this antibody helps to inhibit its activity, reducing inflammation levels in the body.</p>

<p>CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI</p>

<p>FHL2 antibody was raised in rabbit using the C terminal of FHL2 as the immunogen</p>

<p>Rabbit Polyclonal PSMA1 antibody (Ser250)</p>

<p>Rabbit polyclonal NFKB p105/p50 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC3 antibody, catalog no. 70R-4694</p>

<p>Purified Polyclonal Delta NaCH antibody</p>

<p>Purified Rabbit polyclonal OR5D3 antibody</p>

<p>PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC</p>

<p>KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH</p>

<p>SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS</p>

<p>The PMS2 antibody is a highly specific monoclonal antibody that binds to the PMS2 protein, an essential component of the DNA mismatch repair pathway. This antibody is widely used in life sciences research to study DNA repair mechanisms and identify genetic mutations associated with various diseases, including cancer. The PMS2 antibody has been shown to have high affinity and specificity for its target, making it an invaluable tool for immunohistochemistry, Western blotting, and other molecular biology techniques. Additionally, this antibody has been used to investigate the role of PMS2 in cellular processes such as transmembrane conductance and cytokine signaling pathways. With its reactive and activated properties, the PMS2 antibody is a valuable asset for researchers in the field of genetics and molecular biology.</p>

<p>CYP3A5 antibody was raised in rabbit using the N terminal of CYP3A5 as the immunogen</p>

<p>Rat Monoclonal EBNA2 antibody</p>

<p>Peptide H-EQLGEFYEALDCLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal C16orf72 antibody</p>

<p>Rabbit Polyclonal PDCD4 antibody (Ser67)</p>

<p>Rabbit polyclonal AKT1/2/3 antibody (Tyr315/316/312)</p>

<p>Purified Rabbit polyclonal ACOX1 antibody</p>

<p>The S100A8 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect and measure the levels of S100A8 protein in human serum samples. The antibody is immobilized on an electrode and reacts specifically with S100A8, allowing for accurate quantification. In addition to its use in diagnostics, the S100A8 antibody can also be used as a research tool. It can be used to study the role of S100A8 in various biological processes, such as inflammation and immune response. The antibody has neutralizing properties and can inhibit the activity of reactive oxygen species and interleukins. It is also being investigated as a potential therapeutic agent for conditions such as diuretic resistance and influenza hemagglutinin inhibition. With its versatility and specificity, the S100A8 antibody is a valuable tool for researchers in the life sciences field.</p>

<p>The MPG antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has been extensively studied for its ability to detect estradiol levels in various biological samples. This antibody specifically targets and binds to the estradiol molecule, allowing for accurate measurement and analysis.</p>

<p>GOLGA3 antibody was raised in Rabbit using Human GOLGA3 as the immunogen</p>

<p>E. coli antibody was raised in mouse using a number of E. coli serotypes as the immunogen.</p>

<p>Rabbit polyclonal DOCK1 antibody</p>

<p>NCAPH antibody was raised using the C terminal of NCAPH corresponding to a region with amino acids TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG</p>

<p>Akt, or Protein Kinase B (PKB), is a kinase crucial for cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to external signals like growth factors. Activated through phosphorylation at specific sites, Akt influences key cellular processes by promoting cell survival, aiding protein synthesis through mTOR activation, regulating glucose metabolism, and supporting blood vessel formation and cell movement. Its hyperactivation is common in cancers, making it a target for cancer therapies, while its role in glucose regulation links it to insulin resistance and type 2 diabetes.</p>

<p>Cardiac Troponin C Antigen</p>

<p>Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ</p>

<p>Rabbit Polyclonal GUSB antibody</p>

<p>Mouse monoclonal GRHPR antibody</p>

<p>Rabbit polyclonal BRCA1 antibody (Ser1423)</p>

<p>The CEA antibody is a monoclonal antibody that has neutralizing properties and acts as an inhibitor in various Life Sciences applications. It is commonly used in research and diagnostic settings to study the effects of different growth factors, such as TGF-beta and epidermal growth factor. This antibody specifically targets markers like collagen, c-myc, and alpha-fetoprotein, making it a valuable tool for studying their functions and interactions. With its high specificity and affinity, the CEA antibody provides accurate and reliable results in experiments related to cell signaling pathways, cancer research, and immunohistochemistry studies.</p>

<p>The SMAD3 antibody is a powerful tool in the field of molecular biology and immunology. It is a polyclonal antibody that specifically targets the SMAD3 protein, which plays a crucial role in various cellular processes such as chemokine signaling, multidrug resistance, and growth factor regulation. This antibody binds to the SMAD3 protein with high affinity and specificity, allowing researchers to study its function and interactions in different experimental settings.</p>

<p>Rabbit polyclonal RGS20 antibody</p>

<p>The TSP1 antibody is a powerful tool used in Life Sciences. It is an antibody that specifically targets and binds to fibrinogen, a glycoprotein involved in blood clotting. This polyclonal antibody can be used in various applications, such as immunohistochemistry and Western blotting, to detect and quantify the presence of fibrinogen in biological samples. Additionally, the TSP1 antibody has been shown to have cytotoxic effects on cells expressing TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. This monoclonal antibody has also been used in combination with other inhibitors, such as adalimumab, to block the activity of TNF-α, a key mediator of inflammation. With its high specificity and versatility, the TSP1 antibody is an essential component for any researcher working in the field of Life Sciences.</p>

<p>Rabbit polyclonal IL1b antibody (biotin)</p>

<p>Rabbit polyclonal TBCA antibody</p>

<p>FBXO10 antibody was raised using the middle region of FBXO10 corresponding to a region with amino acids SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR</p>

<p>NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI</p>

<p>Rabbit polyclonal ZNF643 antibody</p>

<p>ZNF546 antibody was raised in rabbit using the N terminal of ZNF546 as the immunogen</p>

<p>Mouse monoclonal SULT1C2 antibody</p>

<p>Kcnip3 antibody was raised in rabbit using the middle region of Kcnip3 as the immunogen</p>

<p>Purified recombinant NRIP3 protein (His tag)</p>

<p>PGM1 protein is an EGF-like protein that exhibits growth factor activity. It has been shown to promote the growth and differentiation of hepatocyte-like cells. Monoclonal antibodies specific to PGM1 have been developed and can be used for various applications, including hybridization assays and radionuclide imaging. These antibodies have neutralizing properties, which means they can inhibit the biological activity of PGM1. In addition, PGM1 has been found to have a stimulatory effect on TGF-beta signaling pathway and collagen production in liver microsomes. Overall, PGM1 protein plays a crucial role in cellular growth and tissue development.</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>CDKN1B antibody was raised in Mouse using a purified recombinant fragment of human CDKN1B expressed in E. coli as the immunogen.</p>

<p>SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL</p>

<p>Rabbit polyclonal SRM antibody</p>

<p>Phenylbutazone antibody is a polyclonal antibody that specifically targets and binds to phenylbutazone, a nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively tested for its inhibition concentration against other NSAIDs such as ibuprofen, aminopyrine, piroxicam, and indomethacin. It is widely used in the field of Life Sciences for research purposes. The structural formula of phenylbutazone is available upon request. Phenylbutazone antibody is a valuable tool for studying the pharmacokinetics and pharmacodynamics of this drug and its interactions with other compounds. With its high specificity and sensitivity, this antibody ensures accurate and reliable results in various immunoassays.</p>

<p>Mouse monoclonal KATNAL1 antibody</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK</p>

<p>Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit Polyclonal OR2T1 antibody</p>

<p>Rabbit polyclonal RTN4R antibody</p>

<p>Mouse monoclonal Toll-like receptor 2 antibody (FITC)</p>

<p>KIF3C antibody was raised using the middle region of KIF3C corresponding to a region with amino acids LQEQKERLEEEKAAIQDDRSLVSEEKQKLLEEKEKMLEDLRREQQATELL</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids PRLRTRGSETDGRDQTIALEECNQEGEPGTPANSPSSTSQRISVELPVPI</p>

<p>GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal RPLP2 antibody</p>

<p>HCFC1R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM</p>

<p>HECTD3 antibody was raised in Rabbit using Human HECTD3 as the immunogen</p>

<p>EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA</p>

<p>KIF25 antibody was raised using the C terminal of KIF25 corresponding to a region with amino acids VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL</p>

<p>The PLXDC2 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to specifically target and neutralize the activity of PLXDC2, a glycoconjugate receptor involved in various cellular processes. This antibody has been shown to be cytotoxic against cells expressing high levels of PLXDC2, making it a promising tool for targeted therapy.</p>

<p>Purified recombinant TNFRSF14 protein (His tag)</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>MAST3 antibody was raised in Rabbit using Human MAST3 as the immunogen</p>