Biochemicals and Reagents

<p>Rat monoclonal CD104 antibody (biotin)</p>

<p>Recombinant Human LTBR protein</p>

<p>ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT</p>

<p>Rabbit Polyclonal B4GALT3 antibody</p>

<p>UBE2D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF</p>

<p>BSA conjugated Sulfamonomethoxine Hapten</p>

<p>Luteinizing hormone beta antibody was raised in mouse using human luteinizing hormone as the immunogen.</p>

<p>Ectodysplasin A antibody was raised using the middle region of EDA corresponding to a region with amino acids GPPGPPGPQGPPGLQGPSGAADKAGTRENQPAVVHLQGQGSAIQVKNDLS</p>

<p>MRPL49 antibody was raised in Rabbit using Human MRPL49 as the immunogen</p>

<p>KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN</p>

<p>Rabbit polyclonal BRP44L antibody</p>

<p>C1S antibody was raised in Rabbit using Human C1S as the immunogen</p>

<p>BMP4 antibody was raised in Rabbit using Human BMP4 as the immunogen</p>

<p>The ApoA1 antibody is a monoclonal antibody that plays a crucial role in Life Sciences. It specifically targets and interacts with Apolipoprotein A1 (ApoA1), which is a major component of high-density lipoprotein (HDL) particles. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cardiovascular disorders.</p>

<p>The hCG antibody is a monoclonal antibody that acts as an inhibitor of endothelial growth and has antiangiogenic properties. It can be used in various applications, including research in the field of Life Sciences. This antibody has been shown to effectively target and bind to specific proteins, such as protein kinase and cytotoxic antibodies, which are involved in cell growth and proliferation. The hCG antibody can also specifically recognize and bind to receptors, such as the erythropoietin receptor and c-myc, leading to activation or inhibition of specific pathways. Its high specificity makes it a valuable tool for studying the role of growth factors and their signaling pathways in various biological processes. With its advanced hybridization technology, this antibody offers precise targeting capabilities for researchers in need of accurate results.</p>

<p>PRDM13 antibody was raised in rabbit using the N terminal of PRDM13 as the immunogen</p>

<p>DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD</p>

<p>ACIN1 antibody was raised in mouse using recombinant Human Apoptotic Chromatin Condensation Inducer 1 (Acin1)</p>

<p>Trp-p8 antibody was raised in rabbit using residues 278-292 RNQLEKYISERTIQD and the C terminus sequence NDLKGLLKEIANKIK of the human trp-p8 protein as the immunogen.</p>

<p>Rabbit polyclonal MSH3 antibody</p>

<p>PDE11A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal VN1R4 antibody</p>

<p>Purified recombinant KRAS protein (His tag)</p>

<p>GPC5 antibody was raised in Rabbit using Human GPC5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSD17B11 antibody, catalog no. 70R-4589</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>Rabbit polyclonal WBP1 antibody</p>

<p>Mouse monoclonal GGPS1 antibody</p>

<p>The HSPBP1 antibody is a monoclonal antibody used in the field of Life Sciences. It is a biomolecule that specifically targets and binds to HSPBP1, a growth factor involved in various cellular processes. This antibody has been shown to have high affinity for HSPBP1 and can be used for various research applications.</p>

<p>GNL1 antibody was raised in Rabbit using Human GNL1 as the immunogen</p>

<p>SDF1 alpha antibody was raised in goat using highly pure recombinant murine SDF-1alpha as the immunogen.</p>

<p>Rabbit Polyclonal CEP55 antibody</p>

<p>The FGF2 antibody is a monoclonal antibody that specifically targets and neutralizes fibroblast growth factor 2 (FGF2). It is an ultrasensitive detection tool used in various immunoassays for the detection and quantification of FGF2. This antibody works by binding to FGF2, preventing its interaction with cell surface receptors and inhibiting its signaling pathways. By blocking FGF2 activity, the antibody can inhibit processes such as cell proliferation, angiogenesis, and wound healing that are regulated by FGF2. The FGF2 antibody is widely used in life sciences research, including studies on cancer, cardiovascular diseases, and tissue regeneration. Its high specificity and cytotoxic effects make it an invaluable tool for understanding the role of FGF2 in various biological processes.</p>

<p>Rabbit polyclonal LEG4 antibody</p>

<p>C10ORF46 antibody was raised using the middle region of C10Orf46 corresponding to a region with amino acids SELSEYAAQDQKFQRELIQNGFTRGDQSRKRAGDELAYNSSSACASSRGY</p>

<p>Rabbit polyclonal Pneumolysin antibody (biotin)</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>ZBTB43 antibody was raised in rabbit using the C terminal of ZBTB43 as the immunogen</p>

<p>CARM1 antibody was raised in Rabbit using Human CARM1 as the immunogen</p>

<p>RASGRP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS</p>

<p>Sheep polyclonal Closantel antibody</p>

<p>The SLAMF7 antibody is a highly specialized biomolecule that acts as a growth factor and protein kinase. It is commonly used in Life Sciences research and has proven to be an invaluable tool for scientists in various fields. This monoclonal antibody specifically targets the interleukin-15 receptor, which plays a crucial role in immune response regulation.</p>

<p>SLC8A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE</p>

<p>Rabbit Polyclonal AP4M1 antibody</p>

<p>Mouse monoclonal CBWD1 antibody</p>

<p>Rabbit polyclonal PHLA1 antibody</p>

<p>CHRM3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL</p>

<p>HSPH1 antibody was raised using the middle region of HSPH1 corresponding to a region with amino acids EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ</p>

<p>GSTM3 antibody was raised in Rabbit using Human GSTM3 as the immunogen</p>

<p>Human Thyroid Stimulating Hormone</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>NFKB P65 rel A antibody was raised in rabbit using NFkB p65 (Rel A) peptide corresponding to a region near the C-terminus of the human protein conjugated to KLH as the immunogen.</p>

<p>The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.</p>

<p>Rabbit polyclonal ATN1 antibody</p>

<p>Purified recombinant REXO2 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHAC1 antibody, catalog no. 70R-3936</p>

<p>Portion of EBV EBNA 3C</p>

<p>The TNNT2 antibody is a highly specialized antibody that targets the troponin T protein in cardiomyocytes. It is available in both polyclonal and monoclonal forms, offering flexibility in research applications. This antibody specifically binds to troponin T, which is involved in regulating muscle contraction in the heart. By targeting this protein, researchers can study various aspects of cardiac function and disease.</p>

<p>The p70S6k antibody is an acidic monoclonal antibody that specifically targets the cysteine disulfide region of the p70S6k protein. It has been widely used in Life Sciences research to study the role of p70S6k in various cellular processes. This antibody has neutralizing activity against oncostatin and natriuretic factors, making it a valuable tool for investigating their signaling pathways. Additionally, the p70S6k antibody has been used as a blood biomarker for ultrasensitive detection of leukemia inhibitory factor in human serum samples. With its high affinity and specificity, this monoclonal antibody is an essential tool for researchers studying the primary amino acid sequence and structure of p70S6k using techniques such as electrode-based assays.</p>

<p>Rabbit polyclonal VEGFR2 antibody (Tyr951)</p>

<p>Cu/Zn SOD antibody was raised in rabbit using native human Cu/Zn SOD-1. as the immunogen.</p>

<p>Rabbit polyclonal RPAB1 antibody</p>

<p>ALAD antibody was raised in rabbit using the N terminal of ALAD as the immunogen</p>

<p>Rabbit polyclonal Angiogenin antibody (HRP)</p>

<p>The IL17 antibody is a powerful medicament that plays a crucial role in neutralizing the effects of interleukin-17 (IL-17). This antibody is highly effective in targeting and binding to IL-17, thereby inhibiting its activity. IL-17 is a key player in various inflammatory conditions such as collagen-induced arthritis and cytotoxic T lymphocyte-mediated tissue damage. By blocking the action of IL-17, this antibody helps reduce inflammation and prevents tissue damage caused by excessive immune responses. The IL17 antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the role of IL-17 in various disease models. Whether you're conducting experiments or developing therapies, this monoclonal antibody provides reliable results and consistent performance. Trust in the power of antibodies with our high-quality IL17 antibody.</p>

<p>Mouse monoclonal GTF2F1 antibody</p>

<p>Mouse monoclonal SNX9 antibody</p>

<p>CARS antibody was raised using the middle region of CARS corresponding to a region with amino acids QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK</p>

<p>Purified Polyclonal CD49e HC antibody</p>

<p>Avidin protein is a versatile protein that has various characteristics and applications. It is an EGF-like protein that can be used in Proteins and Antigens research. Avidin protein can be tagged with a monoclonal antibody for specific targeting of cells or molecules. It can also bind to vasoactive intestinal peptide, albumin, human serum albumin, and other proteins, making it useful in various biochemical assays.</p>

<p>Rabbit polyclonal TARS antibody</p>

<p>Rabbit polyclonal STK39 antibody (Ser325)</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>SYT2 antibody was raised in rabbit using the C terminal of SYT2 as the immunogen</p>

<p>Rabbit polyclonal NFKB p105/p50 antibody (Ser927)</p>

<p>IFNGR1 antibody was raised in Rabbit using Human IFNGR1 as the immunogen</p>

<p>Purified recombinant RPS20 protein (His tag)</p>

<p>HIV1 gp120 antibody was raised in rabbit using HIV-1 gp120 as the immunogen.</p>

<p>The HDAC10 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to HDAC10, a histone deacetylase enzyme involved in gene expression regulation. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>IFNG antibody was raised in Rabbit using Human IFNG as the immunogen</p>

<p>HAP40 antibody was raised in rabbit using residues 314-325 [DGHGQDTSGQLP] of the 40 kDa mouse HAP40 protein as the immunogen.</p>

<p>MCB-613 is a novel chemotherapeutic agent that targets the primary tumor by interfering with the physiological function of macrophages. This drug inhibits the production of inflammatory cytokines, such as IL-1β and IL-6, which are important for cancer progression. MCB-613 also has anti-proliferative effects in cells, including inhibition of cell cycle progression at G2/M phase and induction of apoptosis. This drug may be useful in the treatment of cancers such as breast cancer, prostate cancer, and lung cancer.</p>

<p>HJC0152 Hydrochloride is a research compound that acts as a selective agonist of the sphingosine-1-phosphate receptor 5 (S1P5). This compound originates from synthetic chemical sources, where it is meticulously crafted to interact specifically with the S1P5 receptor. Through binding to this receptor, HJC0152 Hydrochloride modulates signaling pathways involved in cellular processes, particularly within the central nervous system.</p>

<p>BAY 2416964 is a chemical compound that is used as an antioxidant in skin care products. It has been shown to have synergistic effects when applied with other antioxidants, such as vitamin E or green tea extract. This compound is used to prevent dehydration and improve the appearance of dry skin. BAY 2416964 also has antioxidant effects, which may help protect against oxidative damage caused by free radicals and reactive oxygen species in the environment. The use of this drug has been reported to help with symptoms of skin conditions such as dermatitis, psoriasis, and eczema. BAY 2416964 has been shown to inhibit the growth of prostate cancer cells "in vitro" by disrupting the cell cycle.</p>

<p>Pyr3 is a TRPC3 channel inhibitor. It selectively blocks the TRPC3 channel, which is involved in regulating mitochondrial membrane potential and ion homeostasis. Pyr3 also has anti-inflammatory properties and may be useful for the treatment of hepatic steatosis or neurodegenerative diseases. The drug can reduce neuronal death by inhibiting the release of neurotransmitters such as neurokinin-1 receptor. Pyr3 also inhibits cardiac contractility, cyclase activity, and disulfide bond formation at low concentrations. This agent also has a potential use as an anti-tumor drug due to its ability to inhibit toll-like receptor signaling pathways that are important in tumor cell proliferation.</p>

<p>AZD5718 is a selective inhibitor of the TRPV1 ion channel. It binds to the receptor and blocks its activity. The TRPV1 ion channel is activated by various stimuli, including capsaicin, heat, low pH, and the endogenous ligand anandamide. AZD5718 has been shown to inhibit pain in animal studies.</p>

<p>MHY 553 is a pharmaceutical preparation that contains propranolol hydrochloride. It has been shown to inhibit the growth of human breast cancer cells in culture by lowering camp levels and reducing the number of fatty acids. MHY 553 also inhibits tumor growth in mice with MDA-MB-231 breast cancer and decreases diastolic blood pressure in rats. MHY 553 has been shown to have a protective effect on experimental models of light-induced skin cancer and to bind DNA, inhibiting transcription and replication.</p>

<p>Portion of EBV</p>

<p>Direct inhibitor of thrombin</p>

<p>E-7766 is a potent anticancer drug that is derived from urine and has been used in medicinal practices for its kinase inhibitory properties. It is an analog of indirubin, a natural compound found in Chinese herbal medicine. E-7766 induces apoptosis in cancer cells by targeting specific protein kinases, which are essential for cell survival and proliferation. This drug has shown promising results in preclinical studies as an inhibitor of various types of cancer, including breast, lung, and prostate cancer. E-7766 has the potential to be a highly effective therapy for the treatment of multiple cancers due to its ability to selectively target cancer cells while sparing healthy cells. Its unique mechanism of action makes it a valuable addition to the arsenal of anticancer drugs available today.</p>

<p>Vitamin D3 analog; regulates bone development via calcium</p>

<p>Dopamine (D2) receptor agonist</p>

<p>Please enquire for more information about Triazadodecanoic acid methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polyvinyl sulfate potassium (PVS) is a polymer that is soluble in water and organic solvents. It has been shown to be an effective inhibitor of the ryanodine receptor, which is responsible for calcium release from the sarcoplasmic reticulum of skeletal and cardiac muscle cells. PVS has also been found to decrease viral life by binding to the surface glycoprotein of HIV-1. This polymer can be used as a cholesterol-lowering agent by binding with cholesterol at high concentrations and preventing its absorption into the bloodstream. PVS has also been shown to have a high resistance to chemical degradation, making it an excellent candidate for use in biomedical devices such as catheters, vascular grafts, and implants.</p>

<p>OATD-01 is a small molecule that has been shown to activate the Ligand-Gated Ion Channel (LGIC) receptor. This receptor regulates the flow of ions and regulates cell membrane potential, which is important in maintaining cell homeostasis. OATD-01 has been shown to be a potent activator of LGIC receptors, inducing ion flux and membrane depolarization.</p>

<p>AZ-PFKFB3-67 is a small molecule that inhibits the activity of the regulatory enzyme phosphofructokinase-2 (PFK2). PFK2 catalyzes the conversion of fructose-6-phosphate to fructose 1,6 bisphosphate in glycolysis. AZ-PFKFB3-67 inhibits the activity of PFK2, which results in decreased production of ATP and may lead to cell death. This compound has also been shown to disrupt blood vessel formation by inhibiting vascular endothelial growth factor receptor 2 signaling.</p>

<p>2-Hydroxy-4-methyl-6-oxo-5-[(5-phenylfuran-2-yl)methylidene]-5,6-dihydropyridine-3-carbonitrile is a small molecule that has been shown to inhibit the activity of a number of different protein kinases. It has been used as a research tool to study the function of ion channels and G protein coupled receptors.</p>

<p>ShK is an amide toxin that is found in the skin of the tropical marine organism Stichodactyla helianthus. It has been shown to have antimicrobial activity against E. coli and other bacteria, as well as a protective effect on inflammatory bowel disease. ShK has been shown to act by inhibiting protein synthesis, which may be due to its ability to bind to signal peptides and change their conformation.</p>

<p>Nocloprost is a synthetic analog of prostaglandin F2α. It is a specific agonist for the prostaglandin receptor, which is found in the epidermal growth factor, protein data, and hematopoietic cells. Nocloprost is taken up by these cells and causes an increase in cytosolic calcium levels. This leads to activation of pancreatic enzymes and hydrochloric acid production. The chemical name for nocloprost is 4-oxo-1-(2-propenyl)-5-(3-phenylpropyl)penta-1,4-dienoic acid methyl ester. The molecular formula is C14H22O3 with a molecular weight of 258.34 g/mol.</p>