Biochemicals and Reagents

<p>TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV</p>

<p>The BACH1 antibody is a polyclonal antibody commonly used in Life Sciences research. It is specifically designed to target and bind to the activated form of BACH1, a human protein involved in various cellular processes. This antibody is highly reactive and can be used in immunoassays to detect and quantify BACH1 levels in biological samples.</p>

<p>MTRF1 antibody was raised in Rabbit using Human MTRF1 as the immunogen</p>

<p>The KRT8 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to specifically target and bind to keratin 8, a protein found in various tissues. This antibody can be used for research purposes, such as detecting and quantifying levels of keratin 8 in samples. The KRT8 antibody is conjugated with magnetic particles, allowing for easy separation and purification of the target protein. With its high specificity and affinity, this monoclonal antibody ensures accurate and reliable results in various applications within the life sciences field. Additionally, it has been shown to have erbb2 inhibitory properties and interacts with spleen ferritin, a metal-binding protein. Its multispecific nature allows for versatility in experimental designs.</p>

<p>IFN Gamma antibody was raised in mouse using recombinant interferon gamma as the immunogen.</p>

<p>HIBADH antibody was raised in Rabbit using Human HIBADH as the immunogen</p>

<p>Purified recombinant TRIAP1 protein (His tag)</p>

<p>The ODC1 antibody is a cytotoxic conjugate that targets the growth factor ODC1. It is a monoclonal antibody that specifically binds to ODC1, inhibiting its activity and preventing cell growth. This antibody has been extensively studied and shown to have potent cytotoxic effects on cancer cells. It is also glycosylated, which enhances its stability and binding affinity. The ODC1 antibody has been used in various research applications, including the development of targeted therapies for cancer treatment. Additionally, it has been investigated as a potential diagnostic tool for detecting autoantibodies against ODC1 in human serum. This antibody shows promise in combination with other therapeutic agents, such as anti-CD20 antibodies or anti-CD33 antibodies, as well as inhibitors of epidermal growth factor (EGF) signaling pathways. Its unique mechanism of action makes it a valuable tool for researchers and clinicians working in the field of oncology.</p>

<p>KRT3 antibody was raised in rabbit using the C terminal of KRT3 as the immunogen</p>

<p>Rabbit polyclonal SLC9A11 antibody</p>

<p>Rabbit polyclonal RARRES3 antibody</p>

<p>Rabbit polyclonal SSFA2 antibody</p>

<p>Rabbit polyclonal PHLDA3 antibody</p>

<p>The Caspase 8 antibody is a highly specific monoclonal antibody that binds to caspase 8, a protein involved in the regulation of cell death. This antibody is commonly used in research and diagnostics within the field of Life Sciences. It has been shown to effectively detect and quantify caspase 8 levels in various samples, including human serum and tissue lysates. The Caspase 8 antibody can be used in applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high affinity binding to caspase 8 allows for accurate detection and analysis of this important protein complex. With its neutralizing properties, this antibody provides valuable insights into the mechanisms of cell death and apoptosis regulation. Trust the Caspase 8 antibody for reliable results in your research endeavors within the Life Sciences field.</p>

<p>Mouse monoclonal Bt Cry1Ab/Ac antibody</p>

<p>Rabbit polyclonal Fetuin B antibody</p>

<p>The SATB1 antibody is a highly specialized monoclonal antibody that has been developed for targeted therapy in various medical applications. This antibody specifically targets and binds to SATB1, a protein that plays a crucial role in gene regulation and cellular function. By binding to SATB1, this antibody can modulate its activity and inhibit the growth of certain cells.</p>

<p>Rabbit polyclonal ACTN4 antibody</p>

<p>Mouse monoclonal APBB3 antibody</p>

<p>POSTN antibody was raised using the middle region of POSTN corresponding to a region with amino acids VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ</p>