Biochemicals and Reagents

<p>Purified recombinant Human RAP1A protein</p>

<p>TNFAIP8L1 antibody was raised using the middle region of TNFAIP8L1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL</p>

<p>Purified recombinant DTD1 protein</p>

<p>LAT3 antibody is a monoclonal antibody that is used as a medicament in the field of Life Sciences. It specifically targets arginase, an enzyme involved in the metabolism of arginine. By blocking the activity of arginase, LAT3 antibody helps to regulate the levels of arginine in the body, which can have various biochemical effects. This antibody has been extensively studied and characterized using hybridoma cell lines and isolated nucleic acids. It has shown high affinity for its target and exhibits excellent specificity for human proteins. LAT3 antibody is widely used in research laboratories and pharmaceutical companies for a variety of applications, including protein analysis, immunohistochemistry, and drug development. Whether you need a monoclonal or polyclonal antibody, LAT3 antibody is a reliable choice that delivers consistent results.</p>

<p>The CADM1 antibody is a high-quality antibody used in various immunocytochemical studies. It specifically targets the human protein CADM1, which plays a crucial role in cell adhesion and signaling. This antibody is produced using recombinant protein technology, ensuring its specificity and reliability.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PINX1 antibody, catalog no. 70R-2144</p>

<p>The Raf1 antibody is a polyclonal antibody that specifically targets the Raf1 protein. It is commonly used in the field of life sciences for research purposes. The Raf1 protein plays a crucial role in cell signaling pathways, particularly in the regulation of cell growth and differentiation. This antibody can be used to detect and quantify the expression levels of Raf1 in various samples, such as serum or tissue extracts. It is highly specific and sensitive, making it a valuable tool for studying the function and activity of Raf1 in different biological processes. Researchers often rely on this antibody to investigate the involvement of Raf1 in diseases like cancer, cardiovascular disorders, and neurological conditions. Its high affinity for the target antigen ensures accurate and reliable results, making it an essential component in many scientific studies.</p>

<p>BAK1 antibody was raised in mouse using recombinant human BAK1 (29-187aa) purified from E.coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rerg antibody, catalog no. 70R-9848</p>

<p>The SOX17 antibody is a highly specialized monoclonal antibody that targets the HER2 protein. It works by binding to β-catenin, a protein involved in cell signaling pathways, and inhibiting its function. This antibody has been extensively tested and has shown excellent results in low-density lipoprotein (LDL) receptor-deficient mice. Additionally, it has been found to have synergistic effects when used in combination with other therapeutic agents such as interferon, caffeine, transferrin, and trastuzumab.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ10490 antibody, catalog no. 70R-9475</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B3 antibody, catalog no. 70R-4646</p>

<p>LYZL4 antibody was raised in Rabbit using Human LYZL4 as the immunogen</p>

<p>Hamster RBC antibody (FITC) was raised in rabbit using hamster erythrocytes as the immunogen.</p>

<p>Rabbit polyclonal SCAMP2 antibody</p>

<p>PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6276</p>

<p>The RAC1 antibody is a monoclonal antibody that specifically targets the RAC1 protein complex. This antibody has a high affinity for RAC1 and can neutralize its activity. It is formulated with excipients such as globulin to ensure stability and effectiveness. The RAC1 antibody belongs to the family of Polyclonal Antibodies, which are widely used in Life Sciences research. It can be used as an antigen in various applications, including Western blotting, immunohistochemistry, and flow cytometry. This antibody is particularly useful for studying the role of RAC1 in cell growth, as well as its interaction with other proteins such as growth factors and mineralocorticoid receptors. Additionally, it has been shown to have low cross-reactivity with other proteins or lipoproteins. Researchers and scientists can rely on the high quality and specificity of this RAC1 antibody for their experiments and studies.</p>

<p>CDC5L antibody was raised in Rabbit using Human CDC5L as the immunogen</p>

<p>The HSPA9 antibody is a powerful tool in the field of Life Sciences. It targets the HSPA9 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research related to epidermal growth factor, erythropoietin, e-cadherin, ketanserin, trastuzumab, and anti-HER2 antibody.</p>

<p>Rabbit polyclonal MCSFR antibody (Tyr723)</p>

<p>KIF3A antibody was raised in Rabbit using Human KIF3A as the immunogen</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH</p>

<p>CCNB1 antibody was raised in Rabbit using Human CCNB1 as the immunogen</p>

<p>HSPA9 antibody was raised in rabbit using the C terminal of HSPA9 as the immunogen</p>

<p>KCTD10 antibody was raised using the middle region of KCTD10 corresponding to a region with amino acids EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI</p>

<p>Rabbit polyclonal PSMA6 antibody</p>

<p>Rabbit polyclonal OSGIN1 antibody</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>Rabbit polyclonal ER alpha antibody (Ser102)</p>

<p>Mouse monoclonal ADI1 antibody</p>

<p>Rabbit polyclonal OLIG1 antibody</p>

<p>The CD9 antibody is a highly activated monoclonal antibody that is used in the field of Life Sciences. It is produced by a hybridoma cell line and has been specifically designed to target the CD9 protein. This antibody has a high affinity for CD9, allowing it to bind to and neutralize its proteolytic activity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PVRL3 antibody, catalog no. 70R-6425</p>

<p>ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL</p>

<p>MEMO1 antibody was raised in Rabbit using Human MEMO1 as the immunogen</p>

<p>Ferritin antibody was raised against Human Ferritin.</p>

<p>The VEGFR2 antibody is a highly specialized polyclonal antibody that is used in various applications within the field of Life Sciences. This antibody specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2), which plays a crucial role in angiogenesis and blood vessel development.</p>

<p>RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF23 antibody, catalog no. 70R-5544</p>

<p>ADORA1 antibody was raised in rabbit using the C terminal of ADORA1 as the immunogen</p>

<p>Rabbit polyclonal RANK antibody (HRP)</p>

<p>The GFRA4 antibody is an affinity ligand that specifically targets interleukin receptors. It has been isolated from retinal tissue and can be used as a test compound in various research studies. This antibody shows potential for the development of new medicines, particularly in the field of nuclear medicine and anti-thrombotic therapies. The GFRA4 antibody is part of a group of antibodies known as polyclonal antibodies, which are widely used as inhibitors or intermediates in various biomedical applications. Additionally, it has shown promise in the detection and treatment of autoantibodies and can be utilized in adeno-associated virus-based therapies. With its versatility and specificity, the GFRA4 antibody holds great potential for advancing scientific research and medical advancements.</p>

<p>Fibrillarin antibody is a polyclonal antibody that is commonly used in life sciences research. It plays a crucial role in various cellular processes, including epidermal growth factor signaling, collagen synthesis, and transferrin regulation. This antibody has been shown to have neutralizing effects on transforming growth factor-beta (TGF-beta), which is involved in cell proliferation and differentiation. Additionally, it has been used as a tool to study the effects of vasoactive intestinal peptide and ketamine on neuronal activity. Fibrillarin antibody is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications in the field of antibodies and multidrug research.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYPLA2 antibody, catalog no. 70R-3616</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C18orf25 antibody, catalog no. 70R-3729</p>

<p>Rabbit polyclonal UGDH antibody</p>

<p>Affinity purified Rabbit polyclonal SLC22A6 antibody</p>

<p>The POSTN antibody is a monoclonal antibody that specifically targets the basic protein POSTN. This antibody is commonly used in life sciences research to study the role of POSTN in various cellular processes. It has been shown to interact with other proteins such as histidine, TGF-beta, collagen, and growth factors. The POSTN antibody is particularly useful for detecting and quantifying the expression levels of POSTN in different cell types and tissues. Its specificity and high affinity make it a valuable tool for understanding the function of this protein in development, wound healing, and tissue remodeling. Additionally, the POSTN antibody can be used in immunohistochemistry, Western blotting, and other experimental techniques to investigate the activation of β-catenin and epidermal growth factor signaling pathways.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. Extensive research has demonstrated its efficacy through the use of advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets and inhibits cell growth in Mycobacterium tuberculosis strains. With its multifaceted mechanism of action and potency against tuberculosis, 6-Fluoro-3-indoxyl-beta-D-galact</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTDSP2 antibody, catalog no. 70R-3514</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR21A antibody, catalog no. 70R-3466</p>

<p>The TAU antibody is a diagnostic agent used in Life Sciences research. It is a monoclonal antibody that specifically targets the cytosolic protein TAU. This antibody has high affinity and specificity for TAU and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. The TAU antibody can also be conjugated to different labels for visualization purposes. Its biophysical properties make it an ideal tool for studying the role of TAU in neurodegenerative diseases such as Alzheimer's disease. Additionally, this antibody has been shown to bind to amyloid plaques in the brain, providing valuable insights into the pathology of these diseases. Its peptide binding capabilities allow for precise targeting of TAU and its associated proteins, making it an essential tool in the field of neuroscience research.</p>

<p>HSZFP36 antibody was raised in rabbit using the middle region of HSZFP36 as the immunogen</p>

<p>Purified recombinant NSMCE1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLK5 antibody, catalog no. 70R-6355</p>

<p>The GAP43 antibody is a human monoclonal antibody that is widely used in the field of Life Sciences. It has been shown to have cytotoxicity against pluripotent cells and is commonly used as a research tool for studying oncogenic kinases. This antibody can be utilized for various applications, including sample composition analysis, biochemical assays, and antigen detection. Additionally, it can be used in flow cytometry experiments to detect human polymorphonuclear leukocytes. With its high specificity and affinity, the GAP43 antibody is an essential tool for researchers working in the field of antibodies and monoclonal antibodies.</p>

<p>Purified recombinant BCAR1 protein (His tag)</p>

<p>KRT7 antibody was raised in Rabbit using Human KRT7 as the immunogen</p>

<p>Armenian Hamster monoclonal CD81 antibody (biotin)</p>

<p>Mouse monoclonal Cytokeratin 10+13 antibody</p>

<p>KCNC3 antibody was raised using the middle region of KCNC3 corresponding to a region with amino acids YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EGLN3 antibody, catalog no. 70R-2564</p>

<p>TGFB1 antibody was raised in rabbit using the middle region of TGFB1 as the immunogen</p>

<p>Na+ Ca2+ exchanger antibody (cardiac) was raised in rabbit using canine cardiac sarcolemma Na+/Ca2+ exchanger as the immunogen.</p>

<p>The CD83 antibody is a monoclonal antibody that targets the CD83 protein. It plays a crucial role in the field of Life Sciences and has various applications in research and diagnostics. This antibody specifically recognizes the CD83 protein, which is expressed on the surface of dendritic cells. It can be used to study the function and activation of dendritic cells, as well as their interaction with other immune cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM12 antibody, catalog no. 70R-5031</p>

<p>SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL</p>

<p>The SIRT5 antibody is a highly specific monoclonal antibody that targets the antigen SIRT5. It is commonly used in various research applications, including immunohistochemistry staining and western blotting. This antibody has high affinity and specificity for its target and can be used as a valuable tool in studying the role of SIRT5 in various biological processes.</p>

<p>CHRAC1 antibody was raised in Rabbit using Human CHRAC1 as the immunogen</p>

<p>HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ</p>

<p>Rabbit polyclonal IKK gamma antibody</p>

<p>PDCD1 antibody was raised in mouse using recombinant human PDCD1 (21-167aa) purified from E. coli as the immunogen.</p>

<p>The VIM antibody is a colloidal growth factor that acts as an inhibitor of tumor necrosis factor-α (TNF-α). It also binds to brain natriuretic peptide and histidine, making it a versatile tool in Life Sciences research. This antibody is part of the family of monoclonal antibodies that have neutralizing properties against various targets, including β-catenin and epidermal growth factor. Additionally, the VIM antibody has been found to exhibit neutralizing effects against botulinum toxin. With its wide range of applications, this antibody is an essential tool for researchers in the field.</p>

<p>C19ORF56 antibody was raised using the N terminal Of C19Orf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML</p>

<p>Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.</p>

<p>Rabbit polyclonal GPR22 antibody</p>

<p>Rabbit polyclonal AML1 antibody (Ser303)</p>

<p>Rabbit polyclonal EMX2 antibody</p>

<p>BMP7 antibody was raised in Rabbit using Human BMP7 as the immunogen</p>

<p>Purified recombinant NT5M protein</p>

<p>Rabbit polyclonal CaMK1A antibody</p>

<p>ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SI antibody, catalog no. 70R-7230</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPNMB antibody, catalog no. 70R-7158</p>

<p>PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids DKDKFPVLVLRKLLDREENPQLKLLLTATDGGKPEFTGSVSLLILVLDAN</p>

<p>CA7 antibody was raised in rabbit using the C terminal of CA7 as the immunogen</p>

<p>Mouse monoclonal KCNJ3 antibody</p>

<p>Mouse monoclonal NSE antibody (Prediluted for IHC)</p>

<p>AK5 antibody was raised in Rabbit using Human AK5 as the immunogen</p>

<p>The ERCC1 antibody is a monoclonal antibody that plays a crucial role in platinum-based chemotherapy. It specifically targets and binds to the ERCC1 antigen, which is involved in DNA repair mechanisms. By binding to this antigen, the ERCC1 antibody inhibits the DNA excision repair process, making cancer cells more susceptible to the effects of chemotherapy.</p>

<p>Purified native Mouse IgG1 protein</p>

<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>

<p>EGLN3 antibody was raised in Rabbit using Human EGLN3 as the immunogen</p>

<p>KIF25 antibody was raised using the N terminal of KIF25 corresponding to a region with amino acids TWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLT</p>

<p>Purified recombinant MPPED2 protein (His tag)</p>

<p>The Human IgG1 protein is a highly versatile and essential component in the field of Life Sciences. This chemokine-activated protein plays a crucial role in various biological processes, including mineralization and antigen recognition. It has been extensively studied for its ability to bind to specific targets, such as influenza hemagglutinin, making it an invaluable tool in research and diagnostic assays. Colloidal gold-labeled Human IgG1 protein is commonly used as a cross-linking agent in immunoassays, where it enables the detection and quantification of specific antibodies. Its high affinity for antigens allows for precise and sensitive measurements, making it an ideal choice for researchers working with monoclonal antibodies or purified immunoglobulins. Moreover, the Human IgG1 protein has been shown to possess neutralizing properties against certain pathogens, further enhancing its value in therapeutic applications. By acting as a family kinase inhibitor, it can modulate immune responses and potentially contribute to the development of novel treatments.</p>

<p>Purified recombinant Human CCNB2 Protein (His tag)</p>

<p>Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY</p>

<p>MAGI1 antibody was raised in Rabbit using Human MAGI1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VSTM2A antibody, catalog no. 70R-5317</p>

<p>Rabbit polyclonal ELK3 antibody (Ser357)</p>

<p>Rat monoclonal B7H1 antibody (biotin)</p>

<p>CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LBP antibody, catalog no. 70R-5907</p>

<p>The MSI1 antibody is a highly reactive monoclonal antibody that is commonly used in Life Sciences research. It is specifically designed to neutralize the activity of the MSI1 protein, which plays a crucial role in various cellular processes. This antibody can be used in immunosuppression studies or as a tool to investigate the function of MSI1 in different biological systems.</p>

<p>Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY</p>

<p>WDR54 antibody was raised in rabbit using the C terminal of WDR54 as the immunogen</p>

<p>The Cystatin C antibody is a highly specialized monoclonal antibody that targets MERTK, a receptor tyrosine kinase involved in cell growth and survival. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been used to detect and quantify Cystatin C levels in human serum, making it a valuable tool for diagnostic purposes. Additionally, this antibody has been used in research studies to investigate the role of MERTK in different cellular processes such as phagocytosis and immune response. Its high specificity and sensitivity make it an ideal choice for scientists looking to explore the functions of MERTK or develop new therapeutic strategies targeting this pathway.</p>

<p>The S100B antibody is a highly specific and potent tool used in Life Sciences research. It is commonly used in gel chromatography and cytokine assays to detect and quantify S100B, a calcium-binding protein that acts as a chemokine and messenger RNA regulator. This antibody is available in both polyclonal and monoclonal forms, derived from plasma or serum, respectively. It has been extensively tested for its efficacy in primary microglial cultures and has shown excellent performance in detecting interleukins and other cytokines. Additionally, the S100B antibody can be used to study the role of c-x-c chemokine receptors in various biological processes. With its high specificity and sensitivity, this antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>Affinity purified Rabbit polyclonal Liprin alpha 1 antibody</p>

<p>The TAU antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies. This antibody specifically targets actin, a protein involved in various cellular processes. It is commonly used in research studies to investigate actin filaments and their role in cell structure and function.</p>

<p>ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL</p>

<p>Sheep polyclonal Epitestosterone antibody</p>

<p>Purified Polyclonal B4GALT3 antibody</p>

<p>CTR9 antibody was raised in Rabbit using Human CTR9 as the immunogen</p>

<p>SLC5A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR</p>

<p>Diclazuril Conjugate for use in immunoassays</p>

<p>CD19 antibody was raised in Mouse using a purified recombinant fragment of human CD19 expressed in E. coli as the immunogen.</p>

<p>BDNF protein is a biomolecule that plays a crucial role in various biological processes. It is commonly used in life sciences research and is available as a recombinant protein. BDNF protein interacts with actin filaments and other cellular components to regulate cell growth, survival, and synaptic plasticity. This protein can be detected using specific monoclonal antibodies or anti-DNP antibodies. BDNF protein is also known to interact with epidermal growth factor (EGF) and other growth factors, making it an important player in cell signaling pathways. Researchers often use BDNF protein inhibitors to study its function and potential therapeutic applications. This product is suitable for use in various experimental setups, including assays involving human serum samples. With its high purity and colloidal properties, BDNF protein offers researchers a reliable tool for their studies in the field of proteins and antigens.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OXSM antibody, catalog no. 70R-2413</p>

<p>ZNF21 antibody was raised in rabbit using the middle region of ZNF21 as the immunogen</p>

<p>Rabbit polyclonal CCL22 antibody (biotin)</p>

<p>Rabbit polyclonal RXRG antibody</p>

<p>The CD200R antibody is a highly specialized antibody that is used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been specifically designed to target CD200R, which is a cell surface receptor involved in immune regulation. This antibody can be used for various applications, including the detection and quantification of CD200R expression in different tissues or cell types.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GC antibody, catalog no. 70R-10253</p>

<p>Rabbit polyclonal KAD1 antibody</p>

<p>Feline Serum Amyloid A, Recombinant</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX1 antibody, catalog no. 70R-1397</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSH2D antibody, catalog no. 70R-10150</p>

<p>Rabbit polyclonal PKIG antibody</p>

<p>Rabbit polyclonal Kininogen 1 antibody (FITC)</p>

<p>Purified native Human TSH alpha protein</p>

<p>ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY</p>

<p>IFN alpha antibody was raised in rabbit using mouse interferon alpha as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CARS antibody, catalog no. 70R-4848</p>

<p>TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI</p>

<p>SLC35F2 antibody was raised using the N terminal of SLC35F2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS</p>

<p>LOC100364462 antibody was raised in rabbit using the middle region of LOC100364462 as the immunogen</p>

<p>CYTH2 antibody was raised in Rabbit using Human CYTH2 as the immunogen</p>

<p>Purified Rabbit polyclonal GRB10 antibody (Tyr67)</p>

<p>MAX antibody was raised in rabbit using the middle region of MAX as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCAS2 antibody, catalog no. 70R-4719</p>

<p>CYP27A1 antibody was raised using the middle region of CYP27A1 corresponding to a region with amino acids SRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A35 antibody, catalog no. 70R-6514</p>

<p>EFNB1 antibody was raised in Rabbit using Human EFNB1 as the immunogen</p>

<p>NEDD4 antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT</p>

<p>SERPINI2 antibody was raised in rabbit using the middle region of SERPINI2 as the immunogen</p>

<p>Rabbit Ig fraction control or blocking reagent</p>

<p>Rabbit Polyclonal Stathmin 1 antibody (Ser37)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIP1 antibody, catalog no. 70R-4677</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB26 antibody, catalog no. 70R-8355</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC732440 antibody, catalog no. 70R-9043</p>

<p>The GLB1 antibody is a trifunctional antibody that is used in bioassays and research in the field of Life Sciences. It has been shown to be effective in neutralizing the activity of human serum, particularly against chemokines. The GLB1 antibody also targets tyrosine kinase receptors and has been used in studies involving alpha-fetoprotein and anti-beta amyloid antibodies. Additionally, this antibody has been found to have genotoxic effects and can inhibit the activity of 3-kinase enzymes. Its versatility and specificity make it a valuable tool for researchers in various fields.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal AFG3L2 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYT9 antibody, catalog no. 70R-7051</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRP19 antibody, catalog no. 70R-1410</p>

<p>Rabbit polyclonal DARP32 antibody (Thr75)</p>

<p>Purified recombinant MEOX2 protein (His tag)</p>

<p>Protein S antibody (HRP) was raised in sheep using human Protein S purified from plasma as the immunogen.</p>

<p>CACNG5 antibody was raised in Rabbit using Human CACNG5 as the immunogen</p>

<p>Purified recombinant Human CTNNBIP1 protein</p>

<p>The CHP antibody is a highly specialized antibody that belongs to the group of polyclonal and monoclonal antibodies. It is designed to target glycopeptides and has neutralizing properties. This antibody can be used in various applications within the field of Life Sciences, including research and diagnostics. The CHP antibody specifically binds to levothyroxine, a hormone involved in regulating metabolism, as well as other glycan molecules. It also has the ability to interact with interleukin-6, a protein associated with inflammation and immune response. Additionally, this antibody can be used for the detection and quantification of plasmids and TNF-α, a pro-inflammatory cytokine. The CHP antibody offers high specificity and sensitivity, making it an essential tool for researchers in various fields.</p>

<p>The PDLIM2 antibody is a monoclonal antibody that specifically targets and binds to the PDLIM2 protein. This antibody is widely used in life sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It can be used as a valuable tool to study the function and localization of PDLIM2 in different cell types and tissues. The PDLIM2 antibody is highly specific and sensitive, ensuring accurate and reliable results. It is an essential component in studies related to gene expression, protein-protein interactions, and signal transduction pathways involving PDLIM2. With its high affinity for the target protein, this antibody provides researchers with a powerful tool to advance their understanding of cellular processes and disease mechanisms.</p>

<p>TAF7L antibody was raised in rabbit using the middle region of TAF7L as the immunogen</p>

<p>Purified native Transferrin protein (Bovine)</p>

<p>Rabbit polyclonal PKG2 antibody</p>

<p>Rabbit polyclonal CBCP2 antibody</p>

<p>FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI</p>

<p>Rabbit Polyclonal Tau antibody (Thr181)</p>

<p>HDAC10 antibody was raised in rabbit using recombinant human HDAC 10 protein as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFS8 antibody, catalog no. 70R-10376</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALPPL2 antibody, catalog no. 70R-1575</p>

<p>C1ORF55 antibody was raised using the C terminal Of C1Orf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID</p>