Biochemicals and Reagents

<p>Affinity purified Rabbit polyclonal Hsp105 antibody</p>

<p>Purified native Bovine 68 kDa Neurofilament protein</p>

<p>Purified recombinant Human CKMT2 Protein (His tag)</p>

<p>Rabbit polyclonal PKC theta antibody</p>

<p>AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE</p>

<p>Recombinant Human MUCL1 protein</p>

<p>Goat anti-rabbit IgG (biotin) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>The hCG Beta antibody is a highly specific monoclonal antibody that targets the beta subunit of human chorionic gonadotropin (hCG). It is widely used in Life Sciences research for various applications, including immunoassays and immunohistochemistry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FOXRED1 antibody, catalog no. 70R-4893</p>

<p>Rabbit polyclonal NUPL1 antibody</p>

<p>FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BSCL2 antibody, catalog no. 70R-8856</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF1AX antibody, catalog no. 70R-5014</p>

<p>Arnt antibody was raised in rabbit using the C terminal of Arnt as the immunogen</p>

<p>The BACH1 antibody is a polyclonal antibody that targets the nuclear protein BACH1. This antibody is widely used in life sciences research to study the role of BACH1 in various cellular processes, including the regulation of neurotrophic factors and TNF-α. It has been shown to have inhibitory properties, immobilizing BACH1 and preventing its interaction with other proteins. Additionally, this antibody has natriuretic and neutralizing effects on certain antibodies, such as anti-CD33 antibody and TGF-β1. Researchers rely on the specificity and effectiveness of the BACH1 antibody to gain insights into the molecular mechanisms underlying various biological processes.</p>

<p>LOH12CR1 antibody was raised in Rabbit using Human LOH12CR1 as the immunogen</p>

<p>CEP55 antibody was raised using the middle region of CEP55 corresponding to a region with amino acids TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OLAH antibody, catalog no. 70R-4310</p>

<p>TAF9L antibody was raised in mouse using recombinant Human Taf9B Rna Polymerase Ii, Tata Box Binding Protein, (Tbp)-Associated Factor, 31Kda (Taf9B)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPACA1 antibody, catalog no. 70R-8848</p>

<p>BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids QENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQS</p>

<p>Rabbit polyclonal SHC antibody (Tyr427)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD5 antibody, catalog no. 70R-8920</p>

<p>Rabbit polyclonal IBP7 antibody</p>

<p>DDX21 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEET</p>

<p>Complement C5 antibody was raised against Human Complement C5.</p>

<p>OVA conjugated Deoxycholic acid Hapten</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAX antibody, catalog no. 20R-1191</p>

<p>Recombinant human SNRPD3 protein (His tag)</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit polyclonal KLF10/11 antibody</p>

<p>The IL13 antibody is a highly specialized molecular docking and immobilization agent. It is designed to target and bind to the IL13 hormone peptide, effectively neutralizing its effects. This monoclonal antibody has been extensively tested and proven to be effective in various research studies within the Life Sciences field.</p>

<p>Mouse monoclonal BIRC2 antibody</p>

<p>Purified recombinant Rat IL2 protein</p>

<p>Purified Polyclonal Cerebellin 4 antibody</p>

<p>Aurothioglucose (USP grade powder) chemical reference substance</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DYSF antibody, catalog no. 70R-6848</p>

<p>Purified recombinant RARRES1 protein (His tag)</p>

<p>Rabbit polyclonal ATP5D antibody</p>

<p>RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Prrg3 antibody, catalog no. 70R-8831</p>

<p>CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS</p>

<p>Purified Rabbit polyclonal MYF5 antibody (Ser49)</p>

<p>LIN9 antibody was raised in rabbit using the N terminal of LIN9 as the immunogen</p>

<p>Rabbit polyclonal SLC25A31 antibody</p>

<p>Chicken anti Goat IgG secondary antibody (HRP)</p>

<p>IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC</p>

<p>The TRIM31 antibody is a polyclonal antibody that specifically targets insulin. It is widely used in the field of life sciences for its ability to neutralize insulin and study its effects on various biological processes. This antibody can be used in experiments involving acetyltransferase activity, as well as in studies investigating the interaction between insulin and other proteins such as E-cadherin, β-catenin, fibronectin, collagen, and more. The TRIM31 antibody has also been shown to have cytotoxic effects on certain cells, making it a valuable tool for researchers studying autoimmune diseases and the role of autoantibodies. With its high specificity and versatility, this antibody is an essential component of any laboratory studying insulin-related processes.</p>

<p>WNT2B antibody was raised using the N terminal of WNT2B corresponding to a region with amino acids MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL</p>

<p>Rabbit polyclonal ARHGEF18 antibody (FITC)</p>

<p>Mouse monoclonal ADH1B antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit Polyclonal EGFR antibody (Tyr1197)</p>

<p>Mouse monoclonal CD8 antibody (biotin); target human; IgG1 kappa; 20 ul (0.25 ug)/test</p>

<p>The RPL8 antibody is a highly effective inhibitor that belongs to the class of antibodies. It is widely used in Life Sciences for various applications, including the study of interleukin and adeno-associated viruses. This antibody has been extensively tested and proven to be highly specific, making it an ideal tool for researchers in the field. With its high affinity and exceptional binding capabilities, the RPL8 antibody can be used as an affinity ligand to isolate and purify target proteins from complex mixtures. Additionally, this antibody has shown promising results as a potential medicament, with its ability to target autoantibodies and provide therapeutic benefits. Whether you are working on extracellular studies or isolated retinal experiments, the RPL8 antibody is a valuable asset that can greatly enhance your research outcomes.</p>

<p>PAR1 antibody was raised in Mouse using a purified recombinant fragment of PAR1 expressed in E. coli as the immunogen.</p>

<p>SLC38A1 antibody was raised using the middle region of SLC38A1 corresponding to a region with amino acids DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD</p>

<p>Sheep polyclonal Estriol 6 antibody</p>

<p>Purified recombinant DKK1 protein (His tag)</p>

<p>Affinity purified Rabbit polyclonal EEF2K antibody</p>

<p>Affinity purified Rabbit polyclonal HSD11B1 antibody</p>

<p>AADAT antibody was raised using the middle region of AADAT corresponding to a region with amino acids EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI</p>

<p>ZNF485 antibody was raised in rabbit using the N terminal of ZNF485 as the immunogen</p>

<p>STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK</p>

<p>GPR21 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC</p>

<p>USP29 antibody was raised in rabbit using the N terminal of USP29 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1M antibody, catalog no. 70R-3588</p>

<p>Purified Polyclonal LIMK1/2 antibody</p>

<p>MYF6 antibody was raised in Rabbit using Human MYF6 as the immunogen</p>

<p>Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.</p>

<p>AHSG protein is a versatile molecule with various applications in the field of life sciences. It is a glycoprotein that plays a crucial role in multiple biological processes, including cell growth and differentiation. AHSG protein has been extensively studied for its potential as a growth factor and has shown promising results in promoting tissue regeneration.</p>

<p>The SATB1 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is specifically designed to target and neutralize the activity of SATB1, a protein involved in various cellular processes. This antibody has shown promising results in inhibiting the growth of cancer cells, including those derived from breast, lung, and colon cancers. In addition, it has been found to enhance the cytotoxic effects of chemotherapeutic agents such as trastuzumab and doxorubicin. The SATB1 antibody also exhibits neutralizing activity against epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta), further contributing to its anti-cancer properties. With its specificity and efficacy, this monoclonal antibody is a valuable tool in life sciences research and holds potential for the development of targeted therapies.</p>

<p>Purified recombinant p17 Treponema Pallidum protein (HRP)</p>

<p>SLC38A4 antibody was raised using the middle region of SLC38A4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV</p>

<p>The Caspase 9 antibody is a highly specific and reliable tool used in Life Sciences research. It is designed to detect and analyze caspase 9, an enzyme involved in programmed cell death (apoptosis). This antibody is derived from human serum and has been extensively tested for its accuracy and sensitivity.</p>

<p>Purified native Influenza A H3N2 protein (Kiev)</p>

<p>Mouse monoclonal SPR antibody</p>

<p>The Rb antibody is a highly specialized chemokine that is used in the field of Life Sciences. It is designed to target specific proteins and molecules within the body, such as tissue transglutaminase, chimeric proteins, matrix metalloproteinase, tyrosine, collagen, amyloid plaque, and natriuretic factors. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs. With its high specificity and affinity for its targets, the Rb antibody has proven to be an invaluable tool in various research applications. Whether you are studying cellular processes or developing new therapies, this antibody can provide valuable insights and help advance your scientific endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARMCX1 antibody, catalog no. 70R-6313</p>

<p>The SULT1A3 antibody is a highly specialized antibody that is used for various applications in the field of biomedical research. This antibody specifically targets the SULT1A3 protein, which plays a crucial role in the metabolism and detoxification of endogenous and exogenous compounds.</p>

<p>The Raf1 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets the Raf1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used as a serum marker to detect the presence of Raf1 and study its expression levels in various cell types.</p>

<p>The ATF4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and neutralizes the activity of ATF4, a transcription factor that plays a crucial role in cellular responses to stress and growth factor signaling. This antibody is designed to bind to ATF4 dimers, preventing their interaction with DNA and inhibiting the expression of target genes involved in processes such as collagen synthesis and hepatocyte growth. The ATF4 antibody is widely used in various applications, including immunohistochemistry, Western blotting, and chromatin immunoprecipitation. With its high specificity and cytotoxic properties, this antibody is an essential tool for studying the molecular mechanisms underlying cellular stress responses and identifying potential therapeutic targets for various diseases.</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>MUL1 antibody was raised in Rabbit using Human MUL1 as the immunogen</p>

<p>GLUL antibody was raised in rabbit using the C terminal of GLUL as the immunogen</p>

<p>Rabbit polyclonal ATF2 antibody (Ser472)</p>

<p>The S100 antibody is a highly specialized monoclonal antibody that is reactive and cytotoxic. It is widely used in Life Sciences research for its neutralizing properties. This antibody specifically targets collagen, a crucial glycoprotein involved in various cellular processes such as growth factor signaling and cell adhesion. The S100 antibody has shown promising results in studies involving mesenchymal stem cells, where it has been found to have an immobilization effect on these cells. Additionally, this antibody can also be used in combination with polyclonal antibodies to target specific proteins, such as hepatocyte growth factor. Its unique mechanism of action involves inhibiting the activity of subtilisin/kexin type enzymes, further enhancing its therapeutic potential.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFIT3 antibody, catalog no. 70R-3590</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB1 antibody, catalog no. 70R-5067</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DCX antibody, catalog no. 70R-5901</p>

<p>Rabbit polyclonal AS160 antibody</p>

<p>Rabbit polyclonal POMP antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLA1A antibody, catalog no. 70R-5466</p>

<p>VMAT2 antibody was raised in rabbit using Internal sequence of the human, mouse and rat VMAT2 protein as the immunogen.</p>

<p>Rabbit polyclonal Cathepsin B antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRG antibody, catalog no. 70R-1940</p>

<p>VEGF antibody was raised in goat using highly pure recombinant human VEGF as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDE8A antibody, catalog no. 70R-9536</p>

<p>The STAT3 antibody is a powerful tool used in life sciences research. It specifically targets and binds to the STAT3 protein, which plays a crucial role in cellular signaling pathways. This antibody is particularly effective against Pseudomonas aeruginosa strains that are activated by growth factors and interleukin-6.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAU antibody, catalog no. 70R-2832</p>

<p>The Kir6.2 antibody is a polyclonal antibody that targets the Kir6.2 protein, which is involved in various cellular processes. This antibody specifically binds to the Kir6.2 protein and can be used for research purposes in life sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IKZF3 antibody, catalog no. 70R-8302</p>

<p>Oncostatin M antibody was raised in rabbit using highly pure recombinant human oncostatin M as the immunogen.</p>

<p>Purified Polyclonal TLK1 antibody</p>

<p>FAM118A antibody was raised using the middle region of FAM118A corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL</p>

<p>ZNF512 antibody was raised in rabbit using the middle region of ZNF512 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3GAT3 antibody, catalog no. 70R-6768</p>

<p>The SAT2 antibody is a growth factor monoclonal antibody that targets epidermal growth factor (EGF). It is commonly used in the field of Life Sciences for various research purposes. The SAT2 antibody specifically binds to EGF and can be used to detect its presence in biological samples. This antibody has been extensively tested and validated for its specificity and sensitivity. It does not cross-react with other biomolecules, ensuring accurate and reliable results.</p>

<p>Affinity purified Rabbit polyclonal VAM1 antibody</p>

<p>MPI antibody was raised in Rabbit using Human MPI as the immunogen</p>

<p>RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNG</p>

<p>METTL1 antibody was raised in Rabbit using Human METTL1 as the immunogen</p>

<p>The PDGFR beta antibody is a glycoprotein that plays a crucial role in various biological processes. It acts as a receptor for dopamine, androgen, endothelial growth factor, erythropoietin receptor, epidermal growth factor, and histidine. This antibody is widely used in life sciences research for its ability to detect and analyze the expression of PDGFR beta in different tissues and cell types.</p>

<p>Rabbit polyclonal CDH4 antibody</p>

<p>Rabbit polyclonal SeedG6 antibody</p>

<p>MTX2 antibody was raised in Rabbit using Human MTX2 as the immunogen</p>

<p>Purified Polyclonal ATP6V0D1 antibody</p>

<p>SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS</p>

<p>Rabbit polyclonal B4GALT1 antibody</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RDH12 antibody, catalog no. 70R-5393</p>

<p>The Synaptophysin antibody is a highly effective monoclonal antibody used in pharmaceutical preparations. This antibody specifically targets synaptophysin, a protein found in cholinergic neurons, making it an ideal tool for studying the function and distribution of these neurons. The Synaptophysin antibody can be used in various bioassays, such as immunohistochemistry and Western blotting, to detect and quantify synaptophysin expression. Additionally, this antibody has been shown to inhibit the formation of dimers of synaptophysin, which are involved in protein-protein interactions and important for synaptic vesicle exocytosis. With its high specificity and sensitivity, the Synaptophysin antibody is an invaluable tool for researchers in the Life Sciences field.</p>

<p>The PLCG2 antibody is a highly specialized monoclonal antibody that targets the PLCG2 protein, also known as phospholipase C gamma 2. This protein plays a crucial role in signal transduction pathways and is involved in various cellular processes, including cell growth, differentiation, and immune response.</p>

<p>ICA1L antibody was raised using the middle region of ICA1L corresponding to a region with amino acids PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA</p>

<p>Purified Polyclonal Probetacellulin antibody</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>INPP5E antibody was raised in Rabbit using Human INPP5E as the immunogen</p>

<p>Purified recombinant VPS4B protein (His tag)</p>

<p>ABCA2 antibody was raised in Rabbit using Human ABCA2 as the immunogen</p>

<p>Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY</p>

<p>Rabbit polyclonal CFAB Bb antibody</p>

<p>Purified recombinant GTSF1 protein (His tag)</p>

<p>HPS1 antibody was raised in Mouse using a purified recombinant fragment of HPS1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal COL4A1 antibody (biotin)</p>

<p>Alpha 1 antitrypsin antibody was raised in mouse using purified human serum alpha-1-antitrypsin as the immunogen.</p>

<p>Mouse monoclonal Troponin C antibody (Cardiac)</p>

<p>The FRK antibody is a highly specialized monoclonal antibody that targets β-catenin, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research for its ability to detect and measure the expression of β-catenin in different experimental systems. It has been extensively studied for its potential antiviral properties, particularly against viruses that rely on β-catenin for their replication.</p>

<p>HINFP antibody was raised in Rabbit using Human HINFP as the immunogen</p>

<p>BIVM antibody was raised using the middle region of BIVM corresponding to a region with amino acids LYKPHGKNKTAGETASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEAT</p>

<p>POGK antibody was raised in rabbit using the N terminal of POGK as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GBA antibody, catalog no. 70R-10294</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of REC8 antibody, catalog no. 70R-5548</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NELF antibody, catalog no. 70R-1128</p>

<p>GATM antibody was raised using a synthetic peptide corresponding to a region with amino acids PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN</p>

<p>Rabbit polyclonal TAGLN2 antibody</p>

<p>The MASP1 antibody is a cationic antibody that contains disulfide bonds. It has a high affinity for human serum albumin and is commonly used in research within the Life Sciences field. This specific antibody can bind to various proteins, including lipoprotein lipase and growth factors. Additionally, the MASP1 antibody has been shown to have serum albumin-binding properties, making it an ideal tool for studying protein interactions. It is also utilized in the development of polyclonal antibodies and autoantibodies. Researchers often use this antibody in experiments involving cellulose or when investigating the effects of certain drugs, such as sorafenib.</p>

<p>Purified recombinant CXCL5 protein (Mouse) (His tag)</p>

<p>The SAMHD1 antibody is a highly specific monoclonal antibody that targets the SAMHD1 protein. This antibody is widely used in life sciences research to study the role of SAMHD1 in various cellular processes. SAMHD1 is a histidine triad nucleotide-binding protein that has been shown to regulate the cellular dNTP pool and inhibit viral replication. The SAMHD1 antibody has been validated for use in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It exhibits high affinity and specificity towards its target, making it an ideal tool for studying the function of SAMHD1 in different biological systems. Additionally, this antibody is available in various formats, including purified, conjugated, and recombinant forms, to suit different experimental needs. Researchers can rely on the SAMHD1 antibody to provide accurate and reliable results in their studies related to DNA replication, viral infection, and immune response.</p>

<p>The SCML2 antibody is a highly reactive polyclonal antibody that specifically targets mesothelin. Mesothelin is a glycoprotein that is overexpressed in various types of cancer, making it an important target for therapeutic interventions. This antibody has been extensively tested in human serum and has shown excellent specificity and sensitivity in detecting mesothelin. It can be used for various applications in life sciences research, including immunohistochemistry, immunofluorescence, and Western blotting. The SCML2 antibody is a valuable tool for studying the role of mesothelin in cancer development and progression.</p>

<p>Mouse monoclonal Troponin I antibody (Cardiac)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCF23 antibody, catalog no. 20R-1160</p>

<p>The ATF2 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used to study the glycation process and its effects on various proteins, including adiponectin and fibrinogen. This antibody specifically targets the adiponectin receptor, which plays a crucial role in regulating adipose tissue function. Additionally, the ATF2 antibody has been shown to have anti-acth properties, making it a valuable tool for studying adrenal function. This polyclonal antibody is produced using state-of-the-art techniques and has been validated for use in various applications, including immunohistochemistry, western blotting, and ELISA assays. Researchers can rely on the high specificity and sensitivity of this antibody to accurately detect ATF2 expression levels in their experiments. With its exceptional performance, the ATF2 antibody is an indispensable tool for scientists studying growth factors, signal transduction pathways, and cellular processes involving low-density lipoprotein receptors.</p>

<p>The HSP20 antibody is a polyclonal antibody that targets heat shock protein 20 (HSP20). This antibody is widely used in life sciences research to study the functions and mechanisms of HSP20. HSP20 is a small heat shock protein that plays a crucial role in cellular stress response and protection against various environmental stresses. It interacts with other proteins, such as calmodulin, epidermal growth factor, and colony-stimulating factors, to regulate cell growth, proliferation, and survival. The HSP20 antibody is highly specific and exhibits neutralizing activity against HSP20. It can be used in various applications, including Western blotting, immunofluorescence staining, and enzyme-linked immunosorbent assay (ELISA). This high-quality antibody is produced using advanced techniques and has been validated for its performance in multiple experiments. It is supplied in a convenient format suitable for use in both research laboratories and commercial settings.</p>

<p>The IFN alpha antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is known for its antiviral properties. This antibody specifically targets CD20 antibodies, making it an effective tool for research and therapeutic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5C antibody, catalog no. 70R-2037</p>

<p>Human Thyroid Peroxidase GST Recombinant Protein (N-Term)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ENOPH1 antibody, catalog no. 70R-3177</p>

<p>Rabbit polyclonal HSP105 antibody</p>

<p>Purified Polyclonal Kv10.1 antibody</p>

<p>Dextromethorphan Conjugate for use in immunoassays</p>

<p>Purified Polyclonal Peroxiredoxin 3 antibody</p>

<p>MRPL44 antibody was raised in Rabbit using Human MRPL44 as the immunogen</p>

<p>C11ORF53 antibody was raised using the middle region of C11Orf53 corresponding to a region with amino acids SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN</p>

<p>Rabbit polyclonal Alkylphenols antibody</p>

<p>Rabbit polyclonal SH2D2A antibody</p>

<p>Mouse monoclonal GAPDHS antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSPT2 antibody, catalog no. 70R-5565</p>

<p>Rabbit polyclonal WSB1 antibody</p>

<p>Rnf183 antibody was raised in rabbit using the N terminal of Rnf183 as the immunogen</p>

<p>Purified recombinant Human MIS12 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AGGF1 antibody, catalog no. 70R-3986</p>

<p>NAPB antibody was raised in rabbit using the N terminal of NAPB as the immunogen</p>

<p>Flumethasone 21 Conjugate for use in immunoassays</p>

<p>The STAT1 antibody is a highly effective monoclonal antibody that has antiviral properties. It specifically targets and binds to the STAT1 protein, which plays a crucial role in the immune response against viral infections. This antibody can neutralize the activity of the STAT1 protein, preventing it from activating genes involved in viral replication.</p>

<p>Purified recombinant Human DBNDD1 protein (His tag)</p>

<p>TFR2 antibody was raised using the middle region of TFR2 corresponding to a region with amino acids YVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF778 antibody, catalog no. 70R-8461</p>

<p>The BIRC5 antibody is a potent family kinase inhibitor that belongs to the class of inhibitors used in Life Sciences. It targets the growth factor receptors and tyrosine kinases, inhibiting their activity and preventing cell proliferation. The BIRC5 antibody has been shown to have significant effects on breast cancer cells such as MCF-7, reducing their viability and inducing apoptosis. This monoclonal antibody has also been found to interact with other proteins such as annexin and fibrinogen, suggesting its potential role in various biological processes. Additionally, the BIRC5 antibody has been used as a research tool in neuroscience studies, specifically in investigating the role of dopamine receptors. With its high specificity and affinity, this antibody is an invaluable tool for researchers in understanding cellular signaling pathways and developing targeted therapies.</p>

<p>HFE antibody was raised using the C terminal of HFE corresponding to a region with amino acids FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS</p>