Biochemicals and Reagents

<p>MSRB2 antibody was raised in Rabbit using Human MSRB2 as the immunogen</p>

<p>Purified recombinant MOCS2 protein (His tag)</p>

<p>Purified Polyclonal GPR52 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YIPF2 antibody, catalog no. 70R-8830</p>

<p>Affinity purified Rabbit polyclonal PDE4B antibody</p>

<p>SERPINA5 antibody was raised using the C terminal of SERPINA5 corresponding to a region with amino acids LPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVL</p>

<p>Rabbit polyclonal SENP5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH7 antibody, catalog no. 70R-6178</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC642141 antibody, catalog no. 70R-2169</p>

<p>COX6B2 antibody was raised in Rabbit using Human COX6B2 as the immunogen</p>

<p>Rabbit polyclonal RDH13 antibody</p>

<p>Mouse monoclonal alpha Actin antibody (muscle)</p>

<p>Rat monoclonal Ly6A/E antibody (FITC)</p>

<p>Rabbit polyclonal YARS2 antibody</p>

<p>Rabbit polyclonal SSBP1 antibody</p>

<p>Rabbit polyclonal TRIP13 antibody</p>

<p>The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.</p>

<p>AGXT2 antibody was raised using the N terminal of AGXT2 corresponding to a region with amino acids TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK</p>

<p>ZNF428 antibody was raised in rabbit using the middle region of ZNF428 as the immunogen</p>

<p>The CXCL12 antibody is a highly effective tool for researchers in the field of immunology. This antibody specifically targets and binds to CXCL12, a chemokine involved in immune responses. By binding to CXCL12, this antibody can modulate immune cell recruitment and activation.</p>

<p>FAM3B antibody was raised in Rabbit using Human FAM3B as the immunogen</p>

<p>Morphine-BSA is a fluorescent probe that is used in various applications in the field of Life Sciences. It consists of morphine, a potent analgesic, conjugated to Bovine Serum Albumin (BSA). This conjugate can be used as a tool to study the binding and internalization of morphine by cells expressing specific receptors. Additionally, Morphine-BSA can be employed in immunoassays for the detection and quantification of morphine or its metabolites. The high specificity of this monoclonal antibody ensures accurate and reliable results. Furthermore, Morphine-BSA can serve as a hapten conjugate for the development of new antibodies or as a control in experiments involving toxin subunits or growth factors. Its emission properties make it suitable for use with various imaging techniques such as fluorescence microscopy or flow cytometry. With its versatility and wide range of applications, Morphine-BSA is an invaluable tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTK6 antibody, catalog no. 70R-5786</p>

<p>Rabbit polyclonal PRMT1 antibody (HRP)</p>

<p>HS3ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV</p>

<p>Purified Polyclonal SYT16 antibody</p>

<p>FAM107A antibody was raised in Rabbit using Human FAM107A as the immunogen</p>

<p>The Anti-CPV Antibody is a cytotoxic monoclonal antibody that specifically binds to cytidine. It is commonly used in Life Sciences research and drug development. This antibody can be utilized in various applications, including electrode-based assays and nanocomposite or colloidal systems. The Anti-CPV Antibody has shown promising results in inhibiting the growth factor signaling pathway and neutralizing autoantibodies, such as insulin antibodies. With its high specificity and potency, this antibody is a valuable tool for studying activated pathways and developing targeted therapies.</p>

<p>Rabbit polyclonal CYB5 antibody (biotin)</p>

<p>Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser167)</p>

<p>Mouse monoclonal CD90.1 antibody (allophycocyanin)</p>

<p>The DLK1 antibody is a highly specific polyclonal antibody that binds to the antigen binding domain of the CB2 receptor. It is used in life sciences research to detect and study cell antigens and human enzymes. This antibody is produced using advanced techniques and has been validated for its high specificity and sensitivity. It can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. The DLK1 antibody is an essential tool for researchers working with biomolecules and studying specific antibodies. Its high affinity and specificity make it ideal for detecting and quantifying target proteins in biological samples. With its ability to bind to actin filaments, this antibody can provide valuable insights into cellular processes and signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A1 antibody, catalog no. 70R-1736</p>

<p>BNP antibody was raised in Mouse using synthetic peptide corresponding to aa (Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Cys) of human BNP, conjugated to KLH as the immunogen.</p>

<p>The Caveolin 1 antibody is a powerful tool in the field of life sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FASTKD2 antibody, catalog no. 70R-3176</p>

<p>Rabbit polyclonal Tuberin antibody (Thr1462)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAIM antibody, catalog no. 70R-3010</p>

<p>Affinity purified Rabbit polyclonal TOM1 like protein 2 antibody</p>

<p>HPS3 antibody was raised in Rabbit using Human HPS3 as the immunogen</p>

<p>The VEGFR1 antibody is a Monoclonal Antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). This receptor plays a crucial role in angiogenesis, the formation of new blood vessels. The VEGFR1 antibody binds to VEGFR1 and inhibits its activity, preventing the binding of vascular endothelial growth factors (VEGFs) and subsequent signaling pathways involved in blood vessel development.</p>

<p>Rabbit polyclonal GRIN2B antibody</p>

<p>CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA</p>

<p>CSRP2BP antibody was raised in mouse using recombinant Human Csrp2 Binding Protein (Csrp2Bp)</p>

<p>Goat anti-rabbit IgG Fc was raised in goat using rabbit igG, Fc fragment as the immunogen.</p>

<p>Rabbit polyclonal Tau antibody (Ser356)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TP53I13 antibody, catalog no. 70R-9110</p>

<p>Rabbit polyclonal PIB5 antibody</p>

<p>Purified recombinant AAGAB protein (His tag)</p>

<p>P53 Monoclonal Antibody (FITC)</p>

<p>Mouse Monoclonal Ebola Virus VP40 antibody</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>Rabbit polyclonal Chl81 antibody</p>

<p>Crystallin Gamma C antibody was raised using the middle region of CRYGC corresponding to a region with amino acids GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE</p>

<p>Rabbit polyclonal SULT4A1 antibody</p>

<p>The PEA15 antibody is an antiviral agent that interacts with interferon and forms an antibody complex. It is widely used in the field of Life Sciences for various applications. The antibody can be used as a colloidal or fluorescent probe for detecting specific molecules or proteins in biological samples. It has been shown to have potential therapeutic effects in conditions such as ischemia-reperfusion injury and certain diseases.</p>

<p>The TRIOBP antibody is a highly specialized monoclonal antibody that targets specific proteins involved in cholinergic and interferon signaling pathways. This antibody is widely used in Life Sciences research to study the function and regulation of these proteins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP30 antibody, catalog no. 70R-3999</p>

<p>RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL</p>

<p>POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFOD1 antibody, catalog no. 70R-3804</p>

<p>The LTA4H antibody is a highly specialized monoclonal antibody that targets the phosphatase enzyme LTA4H. This antibody has been shown to inhibit syncytia formation, which is the fusion of multiple cells into one large cell. Additionally, it neutralizes the activity of growth factors and interleukins, which are important signaling molecules involved in immune responses and inflammation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F2 antibody, catalog no. 70R-1795</p>

<p>Purified Rabbit polyclonal OR10A6 antibody</p>

<p>AFG3L2 antibody was raised in Rabbit using Human AFG3L2 as the immunogen</p>

<p>Rat monoclonal IgG1 Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>Purified recombinant Human ADRM1 Protein (His tag)</p>

<p>BAFF antibody was raised in goat using highly pure recombinant human BAFF as the immunogen.</p>

<p>The JAK2 antibody is a highly specific monoclonal antibody that targets the Janus kinase 2 (JAK2) protein. This antibody is produced by hybridoma cells, which are created by fusing mouse myeloma cells with spleen cells from immunized mice. The resulting hybridoma cell line secretes the JAK2 antibody, which can be purified and used for various applications in life sciences research.</p>

<p>MYH10 antibody was raised in Rabbit using Human MYH10 as the immunogen</p>

<p>Rabbit Polyclonal FLT3 antibody (Tyr599)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC9A9 antibody, catalog no. 70R-6808</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT12 antibody, catalog no. 70R-4138</p>

<p>The NFAT5 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It is commonly used to study the role of NFAT5 in various biological processes, including cell growth, differentiation, and immune response. This antibody specifically binds to NFAT5 protein, preventing its interaction with other molecules and inhibiting its activity.</p>

<p>SLC5A4 antibody was raised in rabbit using the middle region of SLC5A4 as the immunogen</p>

<p>Purified recombinant CD7 protein (His tag)</p>

<p>Goat anti-human IgG was raised in goat using human IgG heavy chain as the immunogen.</p>

<p>PA2G4 antibody was raised in rabbit using the middle region of PA2G4 as the immunogen</p>

<p>The FAM84B antibody is a highly specialized antibody used in Life Sciences research. It targets the FAM84B protein, which plays a crucial role in various cellular processes. This polyclonal antibody is produced by immunizing animals with a specific antigen derived from FAM84B. It recognizes and binds to specific epitopes on the FAM84B protein, allowing for its detection and analysis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCN1B antibody, catalog no. 70R-5206</p>

<p>Region of HCC1 protein corresponding to amino acids TESSSRGPYH PSECCFTYTT YKIPRQRIMD YYETNSQCSK PGIVFITKRG HSVCTNPSDK WVQDYIKDMK EN.</p>

<p>Rabbit Polyclonal ATF4 antibody (Ser245)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPI antibody, catalog no. 70R-10233</p>

<p>Sbk1 antibody was raised in rabbit using the C terminal of Sbk1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDC antibody, catalog no. 70R-1296</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN3 antibody, catalog no. 70R-2964</p>

<p>The GBE1 antibody is a highly specialized detection reagent that plays a crucial role in the field of diagnostic biomarkers. This monoclonal antibody has the unique ability to inhibit the emission of certain proline-rich proteins, making it an invaluable tool for researchers and medical professionals alike.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6152</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Cyb5r2 antibody, catalog no. 70R-9244</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Fam168a antibody, catalog no. 70R-9312</p>

<p>Purified recombinant Human NAPA protein</p>

<p>Region of MEC protein corresponding to amino acids SEAILPIASS CCTEVSHHIS RRLLERVNMC RIQRADGDCD LAAVILHVKR RRICVSPHNH TVKQWMKVQA AKKNGKGNVC HRKKHHGKRN SNRAHQGKHE TYGHKTPY.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNB1 antibody, catalog no. 70R-3117</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SAMSN1 antibody, catalog no. 70R-1961</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM121B antibody, catalog no. 70R-1479</p>

<p>ARL4A antibody was raised in Rabbit using Human ARL4A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A4 antibody, catalog no. 70R-6655</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-6502</p>

<p>293-408 amino acids: MSPKHHSQRA RKKNKNCRRH SLYVDFSDVG WNDWIVAPPG YQAFYCHGDC PFPLADHLNS TNHAIVQTLV NSVNSSIPKA CCVPTELSAI SMLYLDEYDK VVLKNYQEMV VEGCGCR</p>

<p>Rabbit polyclonal Basigin antibody (biotin)</p>

<p>Rabbit polyclonal ADD1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACO2 antibody, catalog no. 70R-2445</p>

<p>The CD4 antibody is a glycosylated monoclonal antibody that specifically targets the CD4 glycoprotein. This antibody is part of a class of Monoclonal Antibodies that are designed to bind to specific antigens in order to modulate immune responses. The CD4 antibody has been extensively studied and shown to have neutralizing effects on the activity of brain natriuretic peptide (BNP), tumor necrosis factor-alpha (TNF-α), and other cytokines. It can also bind to various chemokine receptors and binding proteins, thereby inhibiting their interactions with their ligands. The CD4 antibody has been used in research studies and clinical trials for its potential therapeutic applications, particularly in the field of immunology and autoimmune diseases. Its amino-terminal region plays a crucial role in its binding affinity and specificity. Overall, the CD4 antibody is a valuable tool for understanding immune responses and developing targeted therapies for various diseases.</p>

<p>C5orf44 antibody was raised in Rabbit using Human C5orf44 as the immunogen</p>

<p>200 nm Colloidal Gold particle suspension</p>

<p>The STAT3 antibody is a highly specialized protein complex that specifically targets and neutralizes the activated form of the STAT3 protein. It is available in both polyclonal and monoclonal antibody forms, providing researchers with options for their specific experimental needs.</p>

<p>Purified recombinant Human CDC25A protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MUC15 antibody, catalog no. 70R-6736</p>

<p>Rabbit polyclonal MAPK1/2 antibody</p>

<p>Rabbit polyclonal ARHGDIA antibody</p>

<p>TAAR5 antibody was raised in rabbit using the middle region of TAAR5 as the immunogen</p>

<p>COPS6 antibody was raised in rabbit using the middle region of COPS6 as the immunogen</p>

<p>PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL</p>

<p>The NSE antibody is a highly specialized monoclonal antibody that is used in various assays and experiments in the field of Life Sciences. It has been specifically designed to target and bind to nuclear extracts, allowing for the detection and analysis of specific proteins and markers. The NSE antibody has proven to be particularly effective in detecting proteins such as necrosis factor-related apoptosis-inducing (TNFSF10) and alpha-synuclein, which are involved in important cellular processes.</p>

<p>Region of SDF1 protein corresponding to amino acids KPVSLSYRCP CRFFESHIAR ANVKHLKILN TPNCALQIVA RLKNNNRQVC IDPKLKWIQE YLEKALNKRL KM.</p>

<p>The ACVR2B antibody is a polyclonal antibody that specifically targets the protein kinase ACVR2B. This antibody has been shown to have neutralizing activity against interferon-gamma (IFN-gamma), which plays a crucial role in the immune response. Additionally, it has been found to inhibit the activity of monoclonal antibodies and taxol, making it a valuable tool in cancer research and treatment. The ACVR2B antibody can also be used to study chemokine signaling pathways and autoantibodies associated with autoimmune diseases. In the field of life sciences, this antibody is widely used for research purposes, including the study of human folate metabolism and reactive oxygen species. Its high specificity and affinity make it an essential tool for scientists working in various areas of biomedical research.</p>

<p>ANXA5 protein is a vital component in the field of Life Sciences. It plays a crucial role as an anti-beta amyloid agent and is often used in research studies. ANXA5 protein is a steroid-binding protein that can be targeted by monoclonal antibodies. It is widely used in the development of Proteins and Antigens inhibitors, which are essential for various biomedical applications.</p>

<p>Rabbit polyclonal DRAP1 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR4A1 antibody, catalog no. 70R-1931</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2J2 antibody, catalog no. 70R-9992</p>

<p>Mouse monoclonal MECT1 antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>DYNLL1 antibody was raised using the N terminal of DYNLL1 corresponding to a region with amino acids MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY</p>

<p>Hand2 antibody was raised in rabbit using the C terminal of Hand2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC13 antibody, catalog no. 70R-1661</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF543 antibody, catalog no. 70R-7899</p>

<p>KAT2A antibody was raised in Rabbit using Human KAT2A as the immunogen</p>

<p>FNDC8 antibody was raised in rabbit using the N terminal of FNDC8 as the immunogen</p>

<p>UCP3 antibody is a highly specialized chemokine antibody used in Life Sciences research. It is a polyclonal antibody that targets UCP3, a growth factor involved in various cellular processes. This monoclonal antibody specifically recognizes and binds to activated UCP3, allowing for the detection and analysis of its expression levels in different samples.</p>

<p>ZNF670 antibody was raised in rabbit using the N terminal of ZNF670 as the immunogen</p>

<p>FAM90A1 antibody was raised using the N terminal of FAM90A1 corresponding to a region with amino acids PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP</p>

<p>PTHLH Monoclonal Antibody</p>

<p>Rabbit polyclonal Amylin antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC48628 antibody, catalog no. 70R-3620</p>

<p>MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK</p>

<p>Purified recombinant Human MLF1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SECTM1 antibody, catalog no. 70R-6758</p>

<p>Purified recombinant Human NME3 protein</p>

<p>Rabbit polyclonal p42 MAPK antibody</p>

<p>Goat anti Mouse Kappa Light Chain secondary antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal TSSC1 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Affinity purified Rabbit polyclonal CaMKK beta antibody</p>

<p>The His tag antibody is a powerful tool used in life sciences research. This monoclonal antibody specifically recognizes and binds to the histidine (His) tag, which is commonly fused to recombinant proteins for purification and detection purposes. The His tag antibody is activated and neutralizing, making it highly effective in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It can be used to detect the presence of His-tagged proteins in complex samples or to purify them from crude lysates. With its high specificity and affinity, the His tag antibody ensures accurate and reliable results in protein analysis. Whether you are studying botulinum toxins, carbamazepine metabolism, or any other research involving His-tagged proteins, this antibody is an essential tool that will greatly enhance your experimental success. Trust in the quality of our His tag antibodies for all your research needs.</p>

<p>Methamphetamine-BSA is a protein conjugate that is commonly used in research and diagnostic applications. It consists of methamphetamine, a potent stimulant drug, conjugated to bovine serum albumin (BSA), a widely used protein carrier. Methamphetamine-BSA is commonly used as an antigen to generate specific antibodies for the detection and quantification of methamphetamine in biological samples.</p>

<p>BCA1 antibody was raised in rabbit using highly pure recombinant hBCA-1 as the immunogen.</p>

<p>The GATA3 antibody is a highly specific and potent monoclonal antibody that targets the GATA3 protein. This protein is involved in various cellular processes, including the regulation of gene expression and cell differentiation. The GATA3 antibody has been extensively studied for its role in cancer research, particularly in breast cancer.</p>

<p>Mouse monoclonal REXO2 antibody</p>

<p>The CD28 antibody is a powerful tool used in scientific research and medical applications. It is an antibody that specifically targets the CD28 protein, which plays a crucial role in T-cell activation and immune response regulation.</p>

<p>Myeloperoxidase protein is a multifunctional glycoprotein that plays a crucial role in various biological processes. It contains sugar moieties and has been identified as a growth factor with endonuclease activity. In the field of Life Sciences, myeloperoxidase protein is widely studied for its involvement in immune responses and inflammation.</p>

<p>CLTB antibody was raised in Rabbit using Human CLTB as the immunogen</p>

<p>GPR132 antibody was raised in Rabbit using Human GPR132 as the immunogen</p>

<p>Recombinant E.coli gldA protein</p>

<p>PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY</p>

<p>Cytokeratin 3 Monoclonal Antibody  BSA/Azide Free</p>

<p>Rabbit polyclonal HOXC6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf57 antibody, catalog no. 70R-3643</p>

<p>Rabbit Polyclonal 14-3-3 zeta antibody (Ser58)</p>

<p>RPH3A antibody was raised in rabbit using the N terminal of RPH3A as the immunogen</p>

<p>Histamine-BSA is a hapten conjugate that contains histamine molecules attached to bovine serum albumin (BSA). It is commonly used as an antigen in research and diagnostic applications. Histamine-BSA can be used to study the immune response to histamine, such as the production of specific antibodies or the activation of immune cells. This conjugate can also be used in the development of therapeutic drugs, such as anti-VEGF or TNF-α inhibitors, as it can elicit an immune response against these growth factors. Additionally, Histamine-BSA can be utilized in the production of monoclonal antibodies that have neutralizing effects on histamine or other target molecules. Its applications extend to studies involving endothelial growth and proteins related to heparin-induced thrombocytopenia. In the field of life sciences, Histamine-BSA has proven valuable for research on hemolysis and its effects on adalimumab and oncostatin.</p>

<p>The MRP2 antibody is a highly specific antigen that targets helicobacter and phosphorylcholine. It is a polyclonal antibody that can be used to detect and measure the levels of antibodies in various samples. This antibody has been extensively studied in the field of life sciences and has shown promising results in applications such as autoantibody detection, anti-connexin agent research, annexin binding studies, and substrate siRNA delivery. Additionally, the MRP2 antibody has been used in monoclonal antibody development for targeting macrophage inflammatory responses and chemokine signaling pathways. Its versatility and reliability make it an essential tool for researchers studying telomerase activity and other molecular mechanisms.</p>

<p>EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI</p>

<p>The Anti-Giardia antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets Giardia, a parasite that causes gastrointestinal infections. The antibody works by binding to specific antigens on the surface of Giardia, neutralizing its harmful effects.</p>

<p>Human Amyloid-β</p>

<p>Purified Polyclonal Caspase 1 p20 antibody</p>

<p>The HP antibody is a basic protein that plays a crucial role in various biological processes. It interacts with different molecules such as glucagon, osteopontin, antiphospholipid antibodies, and collagen. This versatile antibody has been extensively studied in the field of Life Sciences due to its wide range of applications.</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.</p>

<p>Region of Neuropoietin protein corresponding to amino acids MAPISPSEPI GQAYSLALYM QKNTSALLQT YLQHQGSPFS DPGFSAPELQ LSTLPSAAVS FKTWHAMEDA ERLSRAQGAF LALTQHLQLV GDDQSYLNPG SPILLAQLGA ARLRAQGLLG NMAAIMTALG LPIPPEEDTL GFVPFGASAF ERKCRGYIVT REYGHWTDRA VRDLALLKAK YSA.</p>

<p>Rabbit polyclonal CXCL1 antibody (FITC)</p>

<p>AFF4 antibody was raised in Rabbit using Human AFF4 as the immunogen</p>

<p>The RASEF antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target chemokine and interferon-related antigens. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>2810405K02Rik antibody was raised in rabbit using the middle region of 2810405K02Rik as the immunogen</p>

<p>CDK4 antibody was raised in Rabbit using Human CDK4 as the immunogen</p>

<p>The PGD protein is a versatile and potent inhibitor that belongs to the class of Conjugated Proteins. It has been extensively studied for its ability to inhibit various enzymes and proteins, including angiotensin-converting enzyme, chemokines, and growth factors. This protein can be targeted using monoclonal antibodies or peptide agents, which have shown promising results in neutralizing its activity. Additionally, the PGD protein has been found to interact with other important molecules in the body, such as alpha-fetoprotein and erythropoietin. Its presence in human serum suggests its involvement in crucial physiological processes, such as collagen synthesis and cell growth regulation. The study of PGD protein holds significant potential for advancements in the field of Life Sciences.</p>

<p>Rabbit polyclonal AS160 antibody (Thr642)</p>

<p>ICOS antibody is a specific antibody that belongs to the group of agonist proteins known as monoclonal antibodies. It is commonly used in Life Sciences research and drug development. This antibody specifically targets the ICOS (Inducible T-cell CO-Stimulator) protein, which plays a crucial role in immune responses and T-cell activation. By binding to ICOS, this antibody activates the immune system and promotes the production of various growth factors and interleukins. Additionally, ICOS antibody can be used for detecting autoantibodies in human serum samples. Its high specificity and affinity make it an essential tool in biomedical research and diagnostic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPSF1 antibody, catalog no. 70R-4864</p>

<p>CD70 antibody (Preservative Free) was raised in mouse using human WM-1 (Waldenstrom’s macroglobulinemia) cell line as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM29A antibody, catalog no. 70R-9465</p>

<p>NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL</p>