CymitQuimica logo
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Subcategories of "Biochemicals and Reagents"

Found 130577 products of "Biochemicals and Reagents"

Sort by

Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • Biotin-BIM α3 (51-76) (His tag) amide


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50333

    ne
    To inquire
  • SIVmac239 envelope - 87


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Molecular weight:2,317.9 g/mol

    Ref: 3D-PP51050

    ne
    To inquire
  • H-DFEIISDTK^-OH


    <p>Peptide H-DFEIISDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41413

    ne
    To inquire
  • SARS coronavirus E protein


    <p>The SARS coronavirus E protein is a recombinant protein that acts as a binding protein. It plays a crucial role in the growth and development of various factors, including epidermal growth factor, hepatocyte growth factor, and endothelial growth factor. This protein can be used in research and diagnostic applications to study the interactions between different proteins and their effects on cellular processes. Additionally, it can be used as a target for monoclonal antibodies or inhibitors to neutralize its activity. The SARS coronavirus E protein is a valuable tool for understanding the mechanisms of viral infection and developing therapeutic interventions.</p>
    Purity:Min. 95%

    Ref: 3D-30R-2290

    ne
    To inquire
  • H-YAAELHLVHWNTK^-OH


    <p>Peptide H-YAAELHLVHWNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40245

    ne
    To inquire
  • H-LDSIYSSRRFHVRCVAKAVD-OH


    <p>H-LDSIYSSRRFHVRCVAKAVD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LDSIYSSRRFHVRCVAKAVD-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LDSIYSSRRFHVRCVAKAVD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LDSIYSSRRFHVRCVAKAVD-OH at the technical inquiry form on this page</p>
    Purity:Min. 95%

    Ref: 3D-VAB-07549

    1mg
    461.00€
  • H-V^YIHPF-OH


    <p>Peptide H-V^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46832

    ne
    To inquire
  • H-NLVPMVATV-NH2


    <p>Peptide H-NLVPMVATV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49587

    ne
    To inquire
  • LLO (91 - 99)

    CAS:
    <p>LLO (91 - 99)</p>
    Formula:C47H67N11O17
    Molecular weight:1,058.1 g/mol

    Ref: 3D-CRB1000725

    1mg
    254.00€
    500µg
    186.00€
  • HSA (55-66)


    <p>The HSA (55-66) peptide is derived from human serum albumin (HSA), a protein present in the blood plasma. It is involved in the transportation of compounds through the blood stream, the maintenance of osmotic blood pressure and could be used to improve drug delivery.</p>
    Color and Shape:Powder
    Molecular weight:1,455.7 g/mol

    Ref: 3D-CRB1001151

    1mg
    349.00€
    500µg
    254.00€
  • H-LTVEDPVTVEYITR^-OH


    <p>Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41489

    ne
    To inquire
  • Pru P 1 protein


    <p>Purified recombinant Pru P 1 protein</p>
    Purity:Min. 95%

    Ref: 3D-30R-3072

    100µg
    593.00€
  • H-GPGGVWAAK^-OH


    <p>Peptide H-GPGGVWAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40587

    ne
    To inquire
  • LYVE1 protein (Mouse)


    <p>Purified recombinant Mouse LYVE1 protein</p>
    Purity:Min. 95%

    Ref: 3D-30R-AL009

    20µg
    309.00€
  • H-ATFQTPDFIVPLTDLR^-OH


    <p>Peptide H-ATFQTPDFIVPLTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40915

    ne
    To inquire
  • Histone H3 (32-38) K36Me2


    <p>Histone H3 (32-38) K36Me2 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter to change the positioning of the nucleosome, allowing the DNA it to be either available to the transcription machinery or inaccessible.The Histone H3 (32-38) lysine 36 has been dimethylated.</p>
    Molecular weight:713.4 g/mol

    Ref: 3D-CRB1001551

    1mg
    349.00€
    500µg
    254.00€
  • Influenza HA (518-526)

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C42H69N9O15
    Molecular weight:940.07 g/mol

    Ref: 3D-PP50031

    ne
    To inquire
  • Goat anti Monkey IgG (rhodamine)


    <p>Goat anti-monkey IgG (Rhodamine) was raised in goat using monkey IgG gamma chain as the immunogen.</p>
    Purity:Min. 95%

    Ref: 3D-43R-IG054RD

    1mg
    572.00€
  • APP antibody


    <p>APP antibody was raised in goat using a synthetic peptide corresponding to amino acid residues 44-63 of the N-terminus of the human alzheimer’s APP as the immunogen.</p>
    Purity:Min. 95%

    Ref: 3D-20R-AG004

    250µl
    351.00€
  • Influenza B antibody


    <p>Influenza B antibody was developed using a Victoria strain isolate.</p>

    Ref: 3D-10-I55B

    1mg
    To inquire
    -Unit-mgmg
    To inquire
  • H-L^GGDL^GTYVINK^-OH


    <p>Peptide H-L^GGDL^GTYVINK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48817

    ne
    To inquire
  • Transportan


    <p>Transportan is an amphipathic 27 amino acid peptide that was generated from 12 functional amino acids of galanin and 14 amino acids of mastoparan connected via a lysine residue. Transportan has been functionally characterised as a cell penetrating peptide (CPP) that does not appear to be mediated by endocytosis. All cell types tested were permeated by transportan, initially localising to the outer membrane it then travels to cytoplasmic membrane structures and eventually perfuses to the nucleoli. This CPP has been used for numerous applications and assays to great effect including indirect immunofluorescence and drug delivery.TP reveals some characteristic features of both galanin and mastoparan since it inhibits the binding of galanin to GALR-1 receptor as well as modulates the activity of G proteins due to the inhibition of GTPase activity.</p>
    Color and Shape:Powder
    Molecular weight:2,180.4 g/mol

    Ref: 3D-CRB1001418

    1mg
    477.00€
    500µg
    349.00€
  • LCBiot-LQPELDSFKEELDKY-OH


    <p>Peptide LCBiot-LQPELDSFKEELDKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47983

    ne
    To inquire
  • H-IQILEGWK^-OH


    <p>Peptide H-IQILEGWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48127

    ne
    To inquire
  • CMVpp65 - 8 (RGDTPVLPHETRLLQ)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Molecular weight:1,732 g/mol

    Ref: 3D-PP50978

    ne
    To inquire
  • Ac-MEEVD-OH


    <p>Peptide Ac-MEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48168

    ne
    To inquire
  • Ac-CAEAETAKDN-OH


    <p>Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46547

    ne
    To inquire
  • H-GEGIEEFLR^-OH


    <p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49693

    ne
    To inquire
  • H-PGP-NH2


    <p>Peptide H-PGP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44253

    ne
    To inquire
  • Itraconazole Reference Standard


    <p>The Itraconazole Reference Standard is a highly reliable and accurate biological reagent used in various life science applications. It is specifically designed for neutralizing NS3 protease activity and can be used in the quantitation of monoclonal antibodies, protein kinase inhibitors, and other related assays.</p>
    Purity:Min. 95%

    Ref: 3D-50R-R51211

    50mg
    183.00€
  • H-QVSSHIQVLAR^-OH


    <p>Peptide H-QVSSHIQVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Purity:Min. 95%

    Ref: 3D-PP47324

    ne
    To inquire
  • H-ELVVDFLSYK^-OH


    <p>Peptide H-ELVVDFLSYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41549

    ne
    To inquire
  • M12 muscle-homing peptide


    <p>Gene therapy is potentially an ideal treatment for muscle tissue myopathies but targeting remains an issue. The large volume of muscle in the body versus the requirement for tissue-specificity is of particular concern. This heptapeptide has been shown to preferentially bind myofibers and thus can be used to study targeting of peptide/gene- delivery to muscle tissue. Research into gene therapy of Duchenne muscular dystrophy (DMD) and Spinal muscular atrophy (SMA) has been of particular interest with muscle targeting peptides.- This product has been shown to orientate to muscle and heart tissue and when conjugated to a phosphorodiamidate morpholino oligomer (PMO)-increases dystrophin expression by 25%. This product already shows ideal placement to continue cardiac research to overcome some of these issues.</p>
    Color and Shape:Powder
    Molecular weight:1,416.8 g/mol

    Ref: 3D-CRB1001635

    1mg
    254.00€
    500µg
    186.00€
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2


    <p>Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).</p>

    Ref: 3D-PP41946

    ne
    To inquire
  • H-GALALAQAVQR^-OH


    <p>Peptide H-GALALAQAVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42037

    ne
    To inquire
  • H-AL^P^AP^IEK^-OH


    <p>Peptide H-AL^P^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47421

    ne
    To inquire
  • PLP (178-191)

    CAS:
    <p>PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).</p>
    Formula:C70H106N18O22S
    Molecular weight:1,583.8 g/mol

    Ref: 3D-PP50831

    ne
    To inquire
  • H-DPIYFTGLASEPGAR^-OH


    <p>Peptide H-DPIYFTGLASEPGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42417

    ne
    To inquire
  • H-LSLEIEQLELQR^-OH


    <p>Peptide H-LSLEIEQLELQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42669

    ne
    To inquire
  • H-CGGIDSETADNLEKTTA-OH


    <p>H-CGGIDSETADNLEKTTA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGIDSETADNLEKTTA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGIDSETADNLEKTTA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGIDSETADNLEKTTA-OH at the technical inquiry form on this page</p>
    Purity:Min. 95%

    Ref: 3D-VAB-06264

    1mg
    461.00€
  • H-R^FF-OH


    <p>Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45143

    ne
    To inquire
  • AMARA peptide

    CAS:
    <p>AMARA peptide is a fragment containing the phosphorylation site for AMP activated protein kinase (AMPK) and is a substrate for all AMPK subfamily kinases. As such it is used to measure AMPK related kinase activity.</p>
    Purity:Min. 95%
    Color and Shape:Powder
    Molecular weight:1,541.9 g/mol

    Ref: 3D-CRB1001400

    1mg
    254.00€
    500µg
    186.00€
  • C7


    <p>Selective peptide ligand for FRalpha, demonstrating specific binding to FRalpha expression cells and tumour targeting ability in vivo.</p>
    Molecular weight:1,374.7 g/mol

    Ref: 3D-CRB1001181

    1mg
    254.00€
    500µg
    186.00€
  • H-QWHEDITQDLR^-OH


    <p>Peptide H-QWHEDITQDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42057

    ne
    To inquire
  • H-AGALNSNDAFVLK^-OH


    <p>Peptide H-AGALNSNDAFVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42659

    ne
    To inquire
  • H-IPDEDLAGLR^-OH


    <p>Peptide H-IPDEDLAGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40275

    ne
    To inquire
  • CA 15-3 Grade II (Low Cross-reactivity), Part Purified


    <p>CA 15-3 Grade II (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 15-3 Grade II (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

    Ref: 3D-AU3401-50KU

    ne
    To inquire
  • CCK octapeptide Cholecystokinin (26-33)

    CAS:
    <p>The octapeptide cholecystokinin (26-33), known as CCK-8, has the full biological activity of the full-length cholecystokinin (CCK). CCK acts as a hormone and neurotransmitter and is found in the GI and central nervous systems. CCK-8 is a satiety peptide that inhibits food intake.CCK-8 can also inhibit amanitin uptake into hepatocytes.</p>
    Formula:C49H62N10O13S2
    Molecular weight:1,063.21 g/mol

    Ref: 3D-CRB1000237

    1mg
    254.00€
    500µg
    186.00€
  • Beclin-1


    <p>The Beclin-1 peptide is derived from a region of the Beclin-1 protein, which interacts with a newly identified negative regulator of autophagy, GAPR-1 (also called GLIPR2) to act as a potent inducer of autophagy. Autophagy is an essential process that maintains cellular homeostasis and carries out lysosome-mediated degradation of unwanted proteins in the cytoplasm. It is often examined when looking at disease pathways because of this regulatory function. While the immune system initiates the removal of viruses and pathogens through the autophagic pathway, some viruses (such as HIV) are able to evade this process.</p>
    Molecular weight:2,064.22 g/mol

    Ref: 3D-CRB1000187

    1mg
    254.00€
    500µg
    186.00€
  • H-HTLLVWAPNHYQVVK-OH


    <p>H-HTLLVWAPNHYQVVK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HTLLVWAPNHYQVVK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HTLLVWAPNHYQVVK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HTLLVWAPNHYQVVK-OH at the technical inquiry form on this page</p>
    Purity:Min. 95%

    Ref: 3D-VAB-04349

    1mg
    346.00€