Biochemicals and Reagents

<p>PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL</p>

<p>Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Benzoylecgonine antibody was raised in mouse using benzoylecgonine-BSA as the immunogen.</p>

<p>AAV2 antibody was raised in mouse using recombinant AAV-2 Rep 78 protein, N-terminally truncated by 171 amino acids, as the immunogen.</p>

<p>Peptide H-IKGIKGIK^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Complement C3 is a fundamental factor featured in all three complement system pathways: the classical, lectin and alternative. To activate the complement cascade C3 associates with C3 convertase to produce C3a and C3b. It is also thought that C3 can be cleaved by proteases outside of the complement cascade. C3b can bind to carbohydrate and protein hydroxyl groups through a thioester bond generated by C3 convertase cleavage. This action allows C3b to be used as a 'marker of foreign molecules such as pathogens and ultimately leads to the assembly of the membrane attack complex (MAC) and anaphylatoxin production.Overall the main functions of the complement system are to mark cells for phagocytosis, the recruitment of inflammatory cells and the cell lysis of bacteria cell by the MAC. The anaphylatoxins C3a and C5a recruit neutrophils and causes the inflammatory response while the MAC produces pores in the bacterial membrane thus causing a Ca2+ influx into the cell and bacterial cell death.The complement system as a whole can be associated with the neurological diseases, bacterial meningitis, thrombotic disorders, neurological and autoimmune diseases.The Leucine residue at position 16 of Complement C3 has been isotopically labelled with carbon-13 (6) and nitrogen-15 (1).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Matriptase antibody, catalog no. 70R-12147</p>

<p>This peptide represents the anti-microbial domain of the LL-37 peptide. LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37- this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also has anti-cancer properties and regulates many aspects of the innate immune system, overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis.</p>

<p>Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Serum levels of thyroglobulin (Tg) is considered a valuable measurement for quantitively evaluating thyroid cancer treatment efficacy. Immunoassays are commonly used for Tg level evaluation but return many false negatives. This is due to a large proportion of patients expressing anti-Tg antibodies (TgAb), which outcompete the reagent antibodies for Tg.Liquid chromatography-tandem mass spectrometry (LC-MS/MS) is potentially better at quantification of Tg as TgAb should less influence it.The Tg-VIF heavy arginine residue at position 12 is isotopically labelled with carbon-13 and nitrogen-15. This will allow absolute quantification applications such as quantitative proteomics, the quantification of complex protein mixtures at very low concentrations, or NMR studies.</p>

<p>Mouse monoclonal Zika virus envelope antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>DMNB-caged-Serine is a photolabile caged compound, which is synthesized to incorporate a DMNB (4,5-dimethoxy-2-nitrobenzyl) group onto the serine molecule. This agent is typically produced in specialized chemical laboratories that focus on the development of photolabile protecting groups. The DMNB group acts as a protective moiety that prevents the biological activity of serine by covalently blocking its functional groups until light activation.</p>

<p>Nesfatin-1 is a peptide hormone that is synthesized in the brain, pancreas, and gut. It can be found in human plasma and cerebrospinal fluid. Nesfatin-1 has been shown to decrease food intake through its effects on the hypothalamus. This peptide hormone also stimulates insulin secretion from pancreatic beta cells, which may be due to its ability to inhibit the release of glucagon. Nesfatin-1 has been shown to have a strong effect on glucose homeostasis and may be used as an adjunct therapy for diabetes mellitus type 2 patients who are resistant to metformin treatment.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>HMG-CoA reductase inhibitor</p>

<p>Leu-Enkephalin is an endogenous opioid peptide that has been shown to produce analgesia, anti-inflammatory effects, and changes in locomotor activity. Leu-enkephalin binds to the kappa opioid receptor, which is found in high concentrations in the caudate putamen and hippocampal formation. The enkephalins are a family of basic proteins with two amino acids linked by a single amide bond. They are peptide hormones that act as neurotransmitters in the central nervous system and peripheral nervous system. Leu-enkephalin is a drug candidate for treatment of infectious diseases such as HIV and malaria. In addition, leu-enkephalin has been shown to have side effect profiles that are less severe than morphine or methadone.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Cyclic DAG peptide targets connective tissue growth factor (CTGF/CCN2), present in the extracellular matrix, endothelial cells and overexpressed in several brain diseases. CTGF is a matricellular protein that acts as a regulator of several cellular functions, including cell adhesion, migration, mitogenesis, differentiation, and survival. CTGF is up regulated in Alzheimer's disease, Parkinson's disease, brain injury, glioblastoma, and cerebral infarction.DAG peptide has been shown to home to the brain in mouse models of glioblastoma, traumatic brain injury, and Parkinson's disease when exogenously delivered, making it an attractive target for the treatment of glioblastoma and other brain disorders. DAG may be of use as a tool to enhance delivery of therapeutics and imaging agents to sites of brain diseases.Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.</p>

<p>Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TPSLPTPPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Jelleines are a family of very small (8-9 amino acid residues long) host defence peptides (HDPs) isolated from the royal jelly of honey bees (Apis mellifera). Jelleines do not present any similarity with other HDPs from other honeybees and are produced by the workers and secreted into Royal Jelly (RJ), providing abroad-spectrum protection of the bee hive against microbial infections. The Jelleines are not considered cytolytic or directly involved with inflammatory effects. Jelleine-II may be a product of a tryptic digestion of MRJP-1, which is produced in the hypopharyngeal glands of the worker honeybee and secreted into the RJ- an exoproteinase action either on N-or on C-terminal positions of the tryptic fragment could result in the formation of the Jelleines-I and -IV, respectively. Possess antimicrobial properties against yeast, fungi, gram-positive and gram-negative bacteria.PLEASE NOTE that in several published articles the sequence of Jelleine-2 has been printed as TPFKISLHL-NH2-NH2, due to a mistake in the original reference: Fontana et al., (2004). The correct sequence, is TPFKISIHL-NH2.</p>

<p>Peptide H-ADFPTPSISDFEIPTSNIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Nuclear Factor Erythroid 2-Related Factor 2 (Nrf2) and its negative regulator Kelch-Like ECH-Associated Protein 1 (Keap1) provide vital protection in maintaining cellular redox. In parallel, Nrf2 also aids the resolution of inflammation and also tissue repair. In homeostatic conditions, the transcription factor Nrf2 is controlled in a cytoplasmic complex with Keap1 with ubiquitination and protein degradation. Nrf2 has been linked to numerous cancers due to mutations affecting the binding region of Nrf2 to Keap1, resulting in Nrf2 dissociating from the complex. Nrf2 constitutively accumulates in the nucleus and activation of prosurvival genes that promote cancer cell proliferation.The Neh2 region of Nrf2 interacts with Keap1, as shown by nuclear magnetic resonance spectroscopy. The 16 amino acid peptide (AFFAQLQLDEETGEFL) (69-84) flanks the conserved ETGE motif and can replicate the binding to keap1.Therapeutics targeting the Nrf2 signalling pathway and activation of Nrf2 is a keen area of research, with many cancers being linked to Nrf2, particularly pancreatic cancer. Additionally, activation of Nrf2 has become a possible target as a treatment for COVID. Nrf2 (69-84) replicating full-length Nrf2 binding has been helpful in all cases. This Nrf2 (69-84) contains a covalently bonded N-terminal Biotin tag that can be used for detection and purification. If you would prefer the simple peptide, Nrf2 (69-84), it is available from our catalogue.</p>

<p>Synthetic antineoplastic agent</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>Peptide H-TETSQVAPA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-LPDSNVGVGRHDLGSHRSC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-LPDSNVGVGRHDLGSHRSC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-LPDSNVGVGRHDLGSHRSC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-LPDSNVGVGRHDLGSHRSC-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-PRSPAKLSFQFPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Galanin is a neuropeptide synthesised and released by the brainstem locus coeruleus (LC). Galanin is expressed in most LC neurons in rodents and humans. Galanin has been shown to inhibit LC activity by hyperpolarising LC neurons, suppressing their spontaneous firing rate, and enhancing alpha2-adrenergic receptor-mediated negative feedback. Galanin is also a potent trophic and neuroprotective factor throughout the nervous system.Galanin is widely distributed from the central nervous system, peripheral regions and endocrine system. Galanin's overarching function is as an inhibitory, hyper-polarizing neuromodulator for classical neurotransmitters like acetylcholine and serotonin. Galanin interacts with 3 receptor subtypes GalR1-3 which are G protein-coupled receptors and are inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway but unlike GalR1 there is detectable inositol phosphate production. GalR3 is associated with the Gα pathway, activation of the receptor leads to cellular influx of K+. Each receptor has been associated with neurological diseases such as GalR3 and epilepsy.Galanin protects against a variety of physiological insults in vitro, including excitotoxicity and β-amyloid toxicity. Changes in galanin have been widely studied in relation to Alzheimer's disease and galaninergic neurons have been shown to be spared in late-stage Alzheimer's relative to non-galaninergic neurones.</p>

<p>Cell-penetrating peptides  (CPP) conjugated to biomolecular cargo can provide targeted molecular treatments. This could be revolutionary for numerous conditions such as cancer, muscular dystrophy and many more. CPP often use the endosomal system to enter the cell. Still, they vary in their ability to escape the endosome allowing the cargo to reach its intended area within the cell. Most CPP activity escaping the endosome is weak, and the method is unclear.Dimeric fluorescent TAT (dfTAT) is a CPP composed of 2 TAT peptides with an N-terminal fluorophore tetramethylrhodamine. When incubated with cells, it shows a cytosolic localisation. A simple co-incubation method of dfTAT with a cargo results in efficient endosomal leakage and release of the cargo to the cytosol. dfTAT has been shown to efficiently deliver a wide variety of cargos to the cell, including transcription factors, antibodies, and metal-organic framework (MOF) nanoparticles. One of the significant advantages of using dfTAT is that the co-incubation method of delivery allows dfTAT, and the cargo can be added as separate entities. This enables the controlled titration of material into cells through the modulation of cargo concentration independent of dfTAT.</p>

<p>Inhibits platelet aggregation; vasodilator</p>

<p>Rotavirus antibody was raised in mouse using Intact virus of strains RRV, WA and bovine as the immunogen.</p>

<p>Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QMVQQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PQQPQQSFPQQQRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Troxipide is a gastric cytoprotective agent that is used for the treatment of gastroesophageal reflux disease (GERD). It has anti-inflammatory, anti-ulcer and mucus secreting properties. This drug inhibits proinflammatory mediators in order to restore the normal gastric mucosa.</p>

<p>H-SVLLDAASGQLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVLLDAASGQLR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVLLDAASGQLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVLLDAASGQLR-OH at the technical inquiry form on this page</p>

<p>ELISA kit for detection of Free Cortisol in Saliva in the research laboratory</p>

<p>Inhibitor of cathepsins and other cysteine proteases</p>

<p>Peptide H-GFYAEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Streptavidin antibody (HRP) was raised in rabbit using streptavidin as the immunogen.</p>

<p>Semaglutide is a glucagon-like peptide-1 receptor agonist (GLP-1 RA). It mimics the GLP-1 hormone, released in the gut in response to eating.  Semaglutide can enhance insulin secretion and suppress glucagon section in a glucose-dependent manner. It also increases gastric emptying time and reduces intestinal motility. This combination leads to a decrease in appetite. Semaglutide has a long half-life allowing weekly subcutaneous application. Semaglutide also has positive effects on heart, liver, and lung function. Semalgutide also slows the progression of the effects of Alzheimer’s disease.<br>This is a heavy isotype-labelled version of semaglutide that is suited to peptide quantification by mass spectrometry. This allows it to be used as an internal standard for quantification of semaglutide. There are two phenylalanine residues isotopically labelled with carbon-13 (9) and nitrogen-15 (1); one valine is labelled with carbon-13 (5) and nitrogen-15 (1); two leucine residues labelled with carbon-13 (6) and nitrogen-15 (1). This semaglutide peptide has a mass increase of 40 compared to the unlabelled peptide.25nmol = 0.1mg</p>

<p>Peptide H-HEIPVLPNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Racecadotril is an anti-secretory enkephalinase inhibitor that is used in the treatment of diarrhea. This drug works by inhibiting the enzyme enkephalinase. As a result of this, this drug helps to reduce excess fluid and electrolyte loss from the intestines thereby decreasing the severity of diarrhea.</p>