Product correctly added to cart.

Biochemicals and Reagents
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Read more

Products of "Biochemicals and Reagents"

Sort by


See more categories

This search does not contain any category.

products per page. 178188 products on this category.

discount label

H-LVDQNIFSFYLSR^-OH


Ref: 3D-PP49467

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-QFTSSTSYNR^-OH


Ref: 3D-PP40153

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-DRV^^YIHPFHL-OH


Ref: 3D-PP45856

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

Tat-NR2Baa


Ref: 3D-PP51057

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-MEVGWYRSPFSRVVHLYRNGK-NH2


Ref: 3D-PP42774

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

RS 09


Ref: 3D-PP50693

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

(R)-Phenylephrine HCl - Bio-X ™


Ref: 3D-BP166231

100mg137.00 €
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-FVQENYLEY^-OH


Ref: 3D-PP40269

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

LCBiot-VYATRSSAVRLRSSVP-OH


Ref: 3D-PP48220

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

Fibrinogen antibody (HRP)


Ref: 3D-61R-1023

100µg443.00 €
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-QVSDLISVLR^-OH


Ref: 3D-PP41383

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-VNSQSLSPYLFR^-OH


Ref: 3D-PP40817

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

Insulin antibody


Ref: 3D-10R-I134C

1mg478.00 €
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

CMVpp65 - 92 (EHPTFTSQYRIQGKL)


Ref: 3D-PP50879

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH


Ref: 3D-PP47267

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

CMVpp65 - 82 (QIFLEVQAIRETVEL)


Ref: 3D-PP50971

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

5FAM-EDIIRNIARHLAQVGDSMDR-OH


Ref: 3D-PP48318

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

SIVmac239 - 50


Ref: 3D-PP50192

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

Fluor-YG-OH


Ref: 3D-PP44832

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
discount label

H-VVVGAGDVGK^-OH


Ref: 3D-PP49235

Undefined sizeTo inquire
Estimated delivery in United States, on Wednesday 23 Oct 2024
Welcome to CymitQuimica!We use cookies to enhance your visit. We do not include advertising.

Please see our Cookies Policy for more details or adjust your preferences in "Settings".