Carboxylic Acids

<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>

<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Keto-4-etiocholenic acid is a type of fatty acid that is naturally found in the human body. It is produced by the oxidation of other types of fatty acids and is an intermediate in the synthesis of sex hormones. 3-Keto-4-etiocholenic acid can be synthesized by recombinant methods, which are used to produce proteins for research purposes. It has been shown to have cytostatic effects, which may be due to its irreversible inhibition of enzymes involved in biological function.</p>

<p>Please enquire for more information about Salusin-alpha (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>

<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>

<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>

<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Androstanolone acetate is a synthetic androgen that has been shown to stimulate the production of testosterone in the testes. Androstanolone acetate has been shown to be effective in treating symptoms of male hypogonadism, as well as erectile dysfunction. The drug also has an antigenic effect, which stimulates the production of antibodies against it. Androstanolone acetate binds to cell specific antigens and stimulates cell proliferation. It has been used in cancer prevention studies, where it was found that it could suppress estrogen-induced endometrial cancer in animals. In addition, Androstanolone acetate is capable of stimulating light emission when incubated with cells and can be detected using chromatographic methods.</p>

<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>

<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 3-chlorophenylacetate is a chemical intermediate that has been used in the synthesis of pharmaceuticals and organic compounds. It has also been used as a reagent for research, especially in the study of organic chemistry. Methyl 3-chlorophenylacetate is a versatile building block and can be used as a reaction component to synthesize other chemicals. This compound is also an excellent scaffold for medicinal chemistry.</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>

<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Butanesulfonic acid sodium salt is a perfluorinated compound that inhibits the activity of various enzymes in the body, such as kinases and phosphatases. It has been used to study the effects of these enzymes on chemical reactions. 1-Butanesulfonic acid sodium salt is also used to detect the presence of selenium compounds in urine samples. The inhibition of an enzyme by this compound results in a decreased rate of reaction and a change in kinetic behavior. This can be observed by measuring the time it takes for the reaction to reach half its maximum value. Sodium taurocholate, chloride, and trifluoroacetic acid are all reagents that are commonly used with this compound when performing kinetic studies. 1-Butanesulfonic acid sodium salt has been shown to inhibit cholesterol synthesis in many animal models. In addition, this compound has been shown to bind to and inhibit plasma mass spectrometry by chromatography on silica gel from human plasma</p>

<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>

<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Trifluoromethyl)phenylacetic acid is an isoquinoline alkaloid that has been found to have anti-inflammatory properties. It was shown to inhibit TNF-α production in mice with colitis, reducing the severity of the disease. 3-(Trifluoromethyl)phenylacetic acid can be administered orally, and it is metabolized reductively by dihydroisoquinoline reductase enzymes. The drug's pharmacokinetics are not well understood, but it is thought to be a substrate for CYP3A4 and P-glycoprotein. 3-(Trifluoromethyl)phenylacetic acid has been studied as a potential antiviral agent and systemic inflammatory response inhibitor.</p>

<p>Oleic acid is a naturally occurring monounsaturated fatty acid (C18:1, cis-9-octadecenoic acid) widely used as an excipient in pharmaceutical formulations. Due to its amphiphilic and lipophilic properties, oleic acid is an important drug excipient primarily used to enhance the solubility and bioavailability of poorly water-soluble drugs. As a fatty acid, it is widely used in cosmeceuticals as it acts as a solubilizer in lipid-based systems, an emulsifier in creams and ointments, and a penetration enhancer in transdermal patches, aiding drug absorption through the skin.</p>

<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>

<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4,5-Trimethoxybenzoic acid anhydride is a synthetic chemical compound that is used as a pharmaceutical intermediate. It is mainly used to prepare potent anticancer agents and potent anticancer drugs. 3,4,5-Trimethoxybenzoic acid anhydride reacts with amines in the presence of a base to form substituted amides. This reaction has been shown by crystal x-ray diffraction to be sensitive to the solvent polarity and temperature of the reaction medium. The compound can also react with chloride ion to form 3,4,5-trichlorobenzoic acid anhydride (3TCBA).</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>

<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>

<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>

<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Hydroxynaphthalene-1-sulfonic acid is a chemical compound with the formula HNSO. It is an organic compound and a proton acceptor. The conjugate base of 7-hydroxynaphthalene-1-sulfonic acid has a strong absorption band in the ultraviolet region. In DMF solution, the reaction of 7-hydroxynaphthalene-1-sulfonic acid with formamide, hydroxy, and nitrogen atoms produces a product that has been characterized by photoexcitation and kinetic studies. The proton transfer process from formamide to 7-hydroxynaphthalene-1-sulfonic acid was found to be exponential and followed first order kinetics. The protonation constant for this process was determined to be 8.4 x 10 M/equivalent. 7HNSO can also act as an electron acceptor in dimethylsulphoxide (DMSO) solution</p>

<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>

<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Iloprost is a cyclase inhibitor that is used to treat pulmonary hypertension. It relaxes the smooth muscle cells in the lungs, which causes an increase in blood flow and oxygen levels to the heart and other organs. Iloprost also decreases the production of PGE2 and lowers blood pressure. Iloprost has been shown to be effective in treating chronic viral hepatitis and pulmonary diseases such as primary pulmonary hypertension. This drug can cause hypotension, so it should not be taken by patients with low blood pressure or those who are taking other drugs that can cause hypotension.</p>

<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>

<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>

<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>

<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.</p>

<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>

<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>

<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>

<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Met-RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>