Carboxylic Acids

<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.</p>

<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>

<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>

<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Salusin-alpha (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mercuric acetate is a salt of mercuric and acetic acid. It is used as an antiseptic, disinfectant, and preservative in the food industry. Mercuric acetate has been shown to have anti-inflammatory properties and is used for the treatment of inflammatory bowel disease. The ester linkage between the two molecules allows it to be hydrolysed into its components by enzymes such as esterases or glucuronidases, which may be one of the reasons for its therapeutic effects. Mercuric acetate also reacts with biological molecules, including proteins, nucleic acids, and carbohydrates. This reaction mechanism may contribute to its other biological properties such as lowering blood sugar levels and inhibiting glycolysis in cells that depend on sodium-dependent glucose transport mechanisms.</p>

<p>Please enquire for more information about BNP-26 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>

<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>

<p>Aplysia californica is a species of sea slug that produces a peptide, beta-Bag Cell Peptide (BACP), which has been shown to have depolarizing effects on neurons. BACP can be synthesized from the amino acid sequence of the Aplysia californica cell membrane protein, and this synthetic peptide has been shown to have maximal depolarizing effects at high concentrations. The depolarizing effect of BACP can be seen in populations of neurons as well as individual neurons. This peptide also desensitizes autoreceptors for acetylcholine and serotonin, which may play a role in its electrophysiological effects.</p>

<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (His(3-Me)2)-TRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>

<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>

<p>N-Des(2-diethylamino) metoclopramide acetic acid is a benzyl ester of metoclopramide, a prodrug that is metabolized to the active form in the body. It has been shown to be effective against healthy human subjects and hplc analyses of biological samples have shown it to be a metabolite of metoclopramide. N-Des(2-diethylamino) metoclopramide acetic acid is used as a catalyst for catalytic hydrogenation reactions, such as the conversion of methyl esters into ethyl or butyl esters. It can also be used for catalytic hydrogenation reactions with diazomethane, such as those required for the synthesis of quinolones.</p>

<p>4-Nitrobenzaldiacetate is a crystalline solid that can be obtained by two-dimensional experimental methods. It has been shown to have high reactivity in the presence of ozone and sulfuric acid. The reaction product is the corresponding sulfate salt. The filtration technique is used to separate the desired product from the reaction mixture. This product can also be crystallized with catalytic amounts of sulfuric acid and 4-nitrobenzoic acid. The catalytic oxidation of 4-nitrobenzoic acid to form 4-nitrobenzaldaicetic acid, as well as its subsequent conversion to 4-nitrobenzaldiacetate, are both feasible reactions for this compound.</p>

<p>1,3,6,8-Pyrenetetrasulfonic acid tetrasodium salt (PTS) is a palladium complex that is used as a catalyst in the chemical industry. It can be prepared by the reaction of palladium chloride with sodium sulfide and sodium hydroxide. PTS has been shown to react with diethyl succinate, forming a solid catalyst that can be stored for longer periods of time. This compound has been found to catalyze hydrogenations under constant pressure conditions and also exhibit low energy consumption when performing reactions. PTS is able to bind to DNA, leading to cancer cell death. PTS also has fluorescence properties and can be used in electrochemical impedance spectroscopy.</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>

<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of sitagliptin</p>

<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>

<p>Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Silver trifluoroacetate is a chemical compound that is a silver salt of trifluoroacetic acid. Silver trifluoroacetate is a white crystalline solid, soluble in water and alcohols, but insoluble in ethers. It has the chemical formula AgCF3CO2H. The crystal structure of silver trifluoroacetate has been determined by x-ray diffraction techniques and found to be orthorhombic with space group Pbam. The molecule consists of two 5-membered heteroaromatic rings, one containing carbon atoms and the other containing nitrogen atoms. The nitrogen atom is bonded to six hydrogen atoms and three fluorine atoms, while the carbon atom is bonded to four oxygen atoms and one fluorine atom. Synthesis methods for this compound include reacting silver nitrate with sodium carbonate in water vapor at 120°C.</p>

<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>

<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>2-Chlorooxazole-4-carboxylic acid is a synthetic compound belonging to the group of long-chain aliphatic carboxylic acids. It is an ester that can be synthesized by the reaction of toluene with 2,4-dichlorooxazole. The stereochemical configuration of this molecule is unknown. The synthesis of this compound has been reported in marine invertebrates and plants, including Mycalolide from the marine sponge Mycale sp.</p>

<p>Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.</p>

<p>Please enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>

<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>

<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>

<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Phenyl pyruvic acid is a sodium salt of phenylpyruvic acid that can be synthesized from phenylalanine, an amino acid. It has been shown to have antioxidant and anti-inflammatory properties. Phenyl pyruvic acid was found to inhibit oxidative injury caused by sodium nitroprusside in the rat brain, liver, and heart. Phenyl pyruvic acid also increased the activity of 3t3-l1 preadipocytes and improved energy metabolism in these cells. The synthesis of phenylpyruvate is catalyzed by a decarboxylase enzyme and it can be converted into insulin or phenylalanine.</p>

<p>Clofibric acid is a growth factor-β1 (GF-β1) that is an agonist of the nuclear receptor PPARα. Clofibric acid has been shown to inhibit the activity of benzalkonium chloride, an enzyme that degrades DNA, and it also inhibits polymerase chain reactions. Clofibric acid is believed to act as a competitive inhibitor of the ryanodine receptor. It has been shown to have anti-inflammatory properties in transfection experiments with human cells and may be used in analytical methods for measuring clofibric acid levels in pharmaceutical products.</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Amino-3-fluorobenzoic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Renin Substrate 1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Hydroxyheptanoic acid is a fatty acid that has the hydroxyl group on the seventh carbon. It is biosynthesized from the hydroxylation of heptanal, which is catalyzed by a monooxygenase. The hydroxyl group in 7-hydroxyheptanoic acid can be oxidized to form a carboxylic acid (e.g., 7-ketoheptanoic acid). 7-hydroxyheptanoic acid can also be used as a coating material because it has functional groups and is biodegradable and metal ion free.</p>

<p>Please enquire for more information about FITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Amino-6-fluorobenzoic acid ethyl ester is a chemical that can be used as a building block in the synthesis of more complex compounds. It is a versatile intermediate and can be used to synthesize other important compounds, such as pharmaceuticals. This compound has been shown to be useful for the preparation of 2-amino-4,6-difluorobenzoic acid ethyl ester and many other derivatives. The colorless solid is soluble in ether and dichloromethane.</p>

<p>16-Mercaptohexadecanoic acid (16MHDA) is a fatty acid that has been shown to be an effective inhibitor of the enzyme fatty acid synthase. This enzyme is responsible for the synthesis of long-chain polyunsaturated fatty acids and their derivatives, which are key components of cell membranes and also act as signaling molecules. 16MHDA can be used in the treatment of diseases such as psoriasis, rheumatoid arthritis, and cancer. 16MHDA has been shown to have a high detection sensitivity and activity index when used in electrochemical impedance spectroscopy experiments. The x-ray diffraction data show that 16MHDA forms an acid complex with its substrate, which is thought to be the reaction mechanism. Colloidal gold has been used to study the interaction between 16MHDA and DNA duplexes. This compound was also found to have monoclonal antibody binding properties in human serum samples.</p>

<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>

<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>

<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt is a potent inhibitor of the enzyme kallikrein, which is involved in the production of kinins. It has been shown to inhibit bradykinin breakdown by inhibiting kallikrein and thus prolonging the effects of this hormone. Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt also inhibits aldosterone levels in plasma and reduces glucocorticoid levels, which may be due to its ability to inhibit plasma renin concentrations.</p>

<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Thrombin Receptor Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>

<p>Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt is a peptidomimetic with peroxidase activity. It has the ability to bind to red blood cells and monoclonal antibodies, which are used in spatially specific immunoassays. Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt also has an effect on hyperresponsiveness and can be used as a costimulatory antigen for cancer immunotherapy.</p>