Carboxylic Acids

<p>Please enquire for more information about 4-[5-(4-Pentyloxyphenyl)isoxazol-3-yl]benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GRPP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>

<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.</p>

<p>Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-p-Coumaroylquinic acid is a natural compound found in plants. It has been shown to have antibacterial properties and can be used as an alternative to antibiotics for the treatment of opportunistic fungal infections. 3-p-Coumaroylquinic acid exhibits hypoglycemic activity, which may be due to its ability to inhibit glucose absorption by the gut. This compound can also be analyzed using a surface methodology that involves analyzing the surface of an object with a chemical reagent.</p>

<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>

<p>Please enquire for more information about tert-Butyl oxazol-5-ylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,5-Dibromobenzoic acid methyl ester is an organic compound that has isomers. It is a synthetic substance with the chemical formula CHBrO. This substance can be obtained by reacting benzoic acid with bromine in the presence of aluminium chloride. The nature of this substance is not known due to its multifold structure. 3,5-Dibromobenzoic acid methyl ester has been shown to absorb light and transfer it to another molecule. This molecule can then emit light of a different wavelength or energy level. The dipole moment of the substance interacts with other molecules in close proximity, leading to the transfer of electrons and photons from one molecule to another.</p>

<p>TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.</p>

<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>

<p>Pentafluoropropionic acid is a glycol ether that is used in the preparation of coumarin derivatives. It reacts with sodium carbonate and trifluoroacetic acid to form the corresponding acyl chloride, which then reacts with nitrogen atoms (e.g., ammonia) to form an amide or urea derivative. Pentafluoropropionic acid also reacts with hydrogen fluoride to form pentafluoropropane and hydrogen fluoride gas, which can be used as a propellant for aerosol sprays. Pentafluoropropionic acid binds to toll-like receptors on cancer cells and human serum, inhibiting their ability to synthesize DNA. The compound has been shown to inhibit tumor growth in mice by blocking the formation of cancer tissues.</p>

<p>Clofibric acid is a growth factor-β1 (GF-β1) that is an agonist of the nuclear receptor PPARα. Clofibric acid has been shown to inhibit the activity of benzalkonium chloride, an enzyme that degrades DNA, and it also inhibits polymerase chain reactions. Clofibric acid is believed to act as a competitive inhibitor of the ryanodine receptor. It has been shown to have anti-inflammatory properties in transfection experiments with human cells and may be used in analytical methods for measuring clofibric acid levels in pharmaceutical products.</p>

<p>Sodium dimethyldithiocarbamate hydrate is a salt of dimethyldithiocarbamic acid. It is used as an additive in paints and coatings to prevent corrosion of metal. Sodium dimethyldithiocarbamate hydrate is also used in the production of polyurethane and polyester resins, where it acts as a curing agent. Dimethyldithiocarbamic acid has been shown to be a ligand for the influenza virus, inhibiting viral activity by binding to the hemagglutinin protein. The crystal system of this substance is hexagonal; its salts exist in both acidic and basic forms. The functional theory explains the stabilization of this compound through coordination with nitrogen atoms on one side and phenyl substituents on the other side. Hexamethylenetetramine reacts with sodium chloride to form sodium dimethyldithiocarbamate hydrate, which can then react with methanol or eth</p>

<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>

<p>Please enquire for more information about MCLV3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Glutamic acid alpha-amide is an ester hydrochloride that is a tissue culture amide. It is a cyclic peptide analog and a hydroxyl group. L-glutamic acid alpha-amide has been shown to inhibit the inflammatory response in the bowel disease, Crohn's disease, by blocking the toll-like receptor 4 and 5. This drug also inhibits protein synthesis, which may be due to its ability to bind to fatty acids, thereby inhibiting the production of proteins vital for cell division.</p>

<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C3-Ethylbenzoic acid is an organic compound that can be synthesized from the reactants ethyl bromide, propylene oxide, and acetic anhydride. The synthesis of C3-Ethylbenzoic acid is a stepwise process in which the starting materials are converted to intermediates and then reacted to form the desired product. The reaction mechanism involves bond cleavage, which generates a carboxylic acid group on one end of the molecule and a phenyl group on the other end. C3-Ethylbenzoic acid interacts with clausamine and isoprene during transport through cell membranes. This interaction may lead to increased permeability of cell membranes by c3-ethylbenzoic acid.</p>

<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>

<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>

<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>

<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.</p>

<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>

<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>

<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-13 is a peptide hormone that is secreted from the stomach and small intestine. It may have analgesic effects through its interaction with μ-opioid receptors, which are also activated by morphine. Apelin-13 has been shown to increase locomotor activity in rats, suggesting it can potentiate the antinociceptive effect of morphine.</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-OH acetate salt is a polycarboxylic acid that is found in human immunoglobulins. It has been used as a synthetic substrate for the study of radiation enhancement. H-Arg-Arg-Arg-OH acetate salt is also an allergen and can cause allergic reactions, such as itching and swelling. This compound can be used to study the neutral pH, chemical reactions, protein synthesis, and the hydroxyl group.</p>

<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Defensin HNP-2 is a peptide that has been shown to bind to cancer cells, metabolic disorders, and endometriosis. It also has pharmaceutical preparations for treating microbial infection and other diseases. Defensin HNP-2 is a broad-spectrum antimicrobial peptide and it binds to bacterial membranes in the cell cytoplasm. Defensin HNP-2 may be used as diagnostic agents or in the treatment of microbial infections. This antimicrobial peptide is stable when complexed with calcium ions and can be used against s. aureus strains that are resistant to antibiotics such as ciprofloxacin.</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>

<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>

<p>3-Chloroquinoxaline-2-carboxylic acid is a synthetic compound that has been shown to have antimicrobial properties against bacteria. It is a quinoxaline derivative, which is an important class of compounds for the development of new antibiotics. 3-Chloroquinoxaline-2-carboxylic acid has been shown to inhibit bacterial growth through different mechanisms including blocking DNA synthesis, binding to RNA polymerase, and inhibiting protein synthesis. It also has been shown to be effective against drug resistant bacteria such as methicillin resistant Staphylococcus aureus (MRSA).</p>

<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol.<br>4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DL-3-Amino-3-phenylpropionic acid is an amino acid that is synthesized by the reaction of malonic acid and ethyl ester. This compound is a competitive inhibitor of the enzyme pyruvate carboxylase and inhibits this enzyme in the conversion of pyruvic acid to acetyl CoA, which plays a key role in metabolism. DL-3-Amino-3-phenylpropionic acid has been shown to inhibit the growth of bacteria such as Escherichia coli, Salmonella typhimurium and Staphylococcus aureus. The inhibition of pyruvate carboxylase by DL-3-Amino-3-phenylpropionic acid prevents the production of acetaldehyde from pyruvate, which is toxic to cells.</p>

<p>Dynorphin A (1-11) amide trifluoroacetate salt is a modified form of the opioid peptide dynorphin, which is a natural ligand for kappa-opioid receptors. It has affinity for the surface receptors and can be used to study the modifications that occur in cell function. Dynorphin A (1-11) amide trifluoroacetate salt has been shown to decrease cell function when it interacts with these surface receptors, which are found in brain homogenates and other tissues. Dynorphin A (1-11) amide trifluoroacetate salt also has an effect on brain cells, which may be due to its ability to alter conformational changes in proteins by binding to them. This can lead to alterations in the structure of certain enzymes or receptor proteins.</p>

<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>

<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>

<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>16-Mercaptohexadecanoic acid (16MHDA) is a fatty acid that has been shown to be an effective inhibitor of the enzyme fatty acid synthase. This enzyme is responsible for the synthesis of long-chain polyunsaturated fatty acids and their derivatives, which are key components of cell membranes and also act as signaling molecules. 16MHDA can be used in the treatment of diseases such as psoriasis, rheumatoid arthritis, and cancer. 16MHDA has been shown to have a high detection sensitivity and activity index when used in electrochemical impedance spectroscopy experiments. The x-ray diffraction data show that 16MHDA forms an acid complex with its substrate, which is thought to be the reaction mechanism. Colloidal gold has been used to study the interaction between 16MHDA and DNA duplexes. This compound was also found to have monoclonal antibody binding properties in human serum samples.</p>

<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>

<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>

<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt (2HMP) is a diagnostic agent that can be used for the detection of bacterial infections. The conformational properties of 2HMP are similar to those of ATP, which allows it to bind to the polymerase chain reaction enzyme and initiate an enzymatic reaction. This leads to the production of a signal that can be detected by spectrophotometry or fluorometry. 2HMP has also been shown to have chemokine activity in vitro, but this has not been tested in vivo. 2HMP is a competitive inhibitor of human protein serine proteases, such as trypsin and chymotrypsin, with an IC50 value of approximately 1 μM.</p>

<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Sulfamylbenzoic acid is a model system for the study of transporter and receptor activity. It has been shown to have the ability to inhibit tubule cells in carcinoma cell lines by binding to the protein target, nitrogen atoms, and hydrophobic effect. 4-Sulfamylbenzoic acid has also been shown to bind to the drug transporter and receptor activity. This binding prevents the formation of an inhibitor-transmitter complex with the enzyme that is required for transport or receptor activity, as well as inhibiting protein synthesis and cell division. The kinetic and reaction mechanism are not known at this time.</p>

<p>Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>

<p>Please enquire for more information about N-alpha-Fmoc-Nbeta-allyloxycarbonyl-L-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>

<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>

<p>Phenyl pyruvic acid is a sodium salt of phenylpyruvic acid that can be synthesized from phenylalanine, an amino acid. It has been shown to have antioxidant and anti-inflammatory properties. Phenyl pyruvic acid was found to inhibit oxidative injury caused by sodium nitroprusside in the rat brain, liver, and heart. Phenyl pyruvic acid also increased the activity of 3t3-l1 preadipocytes and improved energy metabolism in these cells. The synthesis of phenylpyruvate is catalyzed by a decarboxylase enzyme and it can be converted into insulin or phenylalanine.</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>

<p>Please enquire for more information about Tert-butyl 4-(3-hydroxypropyl)tetrahydro-1(2H)-pyridinecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Pyridineboronic acid is an antimicrobial agent that is used to treat bacterial and fungal infections. 3-Pyridineboronic acid is a prodrug that is metabolized to its active form, pyridinium boronate. This drug has been shown to be effective in the treatment of hypoxic tumors in mice, which are resistant to other anticancer drugs. 3-Pyridineboronic acid also has acidic properties and can be used as an antiseptic for the treatment of skin and eye infections. It can also be used as a hydrogen bonding partner when combined with halides, such as chloride or bromide ions. The drug binds to human serum proteins and forms an acidic complex that prevents bacterial growth by inhibiting protein synthesis. 3-Pyridineboronic acid also inhibits prostate cancer cells by competitively inhibiting the enzyme 4-pyridinylboronic acid reductase (4PBAR).</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>