Carboxylic Acids

<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>

<p>Oleic acid is a naturally occurring monounsaturated fatty acid (C18:1, cis-9-octadecenoic acid) widely used as an excipient in pharmaceutical formulations. Due to its amphiphilic and lipophilic properties, oleic acid is an important drug excipient primarily used to enhance the solubility and bioavailability of poorly water-soluble drugs. As a fatty acid, it is widely used in cosmeceuticals as it acts as a solubilizer in lipid-based systems, an emulsifier in creams and ointments, and a penetration enhancer in transdermal patches, aiding drug absorption through the skin.</p>

<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>

<p>Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate is an anticancer agent that belongs to the class of formamidines. It is synthesized by refluxing ethyl 4-hydroxyphenylacetic acid with hexamethylenetetramine and acetic acid in ethanol. After purification, it is converted to its active form by reacting with hydrochloric acid. Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate prevents the growth of cancer cells in culture by preventing DNA synthesis, which prevents RNA and protein synthesis. This agent has also been found to suppress paclitaxel production in cultured human breast cancer cells.</p>

<p>Ethoxyiminoacetic acid ethyl ester is an annulated, lactam-containing compound that is synthesized via the condensation of ethyl thiooxamate and carboxylic acid. This drug has been shown to be efficient in inhibiting the growth of bacteria that are resistant to antibiotics such as polycyclic, triazoles, and condensates. It also inhibits protein synthesis by binding to bacterial DNA gyrase and topoisomerase IV. Ethoxyiminoacetic acid ethyl ester has shown significant antimicrobial activity against Gram-positive bacteria such as streptococci and staphylococci.</p>

<p>Maxadilan trifluoroacetate salt is a low-potency drug that binds to the GABA receptor and affects the central nervous system. Maxadilan trifluoroacetate salt is structurally related to leishmaniasis, an infectious disease caused by protozoa of the genus Leishmania. Maxadilan trifluoroacetate salt has been shown to prevent the development of autoimmune diseases in mice, including systemic lupus erythematosus, experimental autoimmune encephalomyelitis, and collagen-induced arthritis. Maxadilan trifluoroacetate salt has also been shown to be effective against cutaneous lesions in mice infected with Leishmania major. The mechanism of action is not yet known but may be due to its ability to influence mitochondrial membrane potential or fatty acid metabolism.</p>

<p>Please enquire for more information about Corticostatin I (rabbit) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>o-Cresol-4-sulphonic acid is a fine chemical with the CAS number 7134-04-5. It is a versatile building block that can be used as a reagent in research, as a speciality chemical and as an intermediate in the production of other compounds. o-Cresol-4-sulphonic acid has been used to synthesize pharmaceuticals, agrochemicals, dyes, perfumes and many more products. This compound has also been used as a reaction component in organic synthesis to form new compounds and scaffolds.</p>

<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans</p>

<p>Trifluoroacetate salt</p>

<p>Docosahexaenoic acid ethyl ester (DHAEE) is a biologically active form of docosahexaenoic acid (DHA), which is an omega-3 polyunsaturated fatty acid. DHAEE is synthesized from DHA through the process of acylation with ethanol. It has been shown to have antioxidant and anti-inflammatory properties in animal studies, as well as improved brain functions. When given to rats, it prevents neuronal death and has been shown to reduce the risk of congestive heart failure.</p>

<p>12-Doxyl stearic acid is a fatty acid that inhibits the vasoactive intestinal peptide (VIP). The inhibitory effect of 12-Doxyl stearic acid on VIP was demonstrated by incubating the cells with this fatty acid and measuring the change in mitochondrial Ca2+ concentration. This inhibition was shown to be due to the inhibition of fatty acids and not an effect on Ca2+ ion channels. Fatty acids are important for normal cellular function, such as maintaining membrane fluidity and aiding in signal transduction. 12-Doxyl stearic acid has been shown to inhibit the production of cardiac fatty acids and may be useful in treating cardiac disorders. 12-Doxyl stearic acid also has a fluorescence probe that can be used to study how cells react to different conditions, such as changes in water vapor or pH levels.</p>

<p>H-Arg-Val-OH acetate salt is a recombinant humanized monoclonal antibody that binds to the serine protease, which is an enzyme that cleaves proteins at specific sites. The antibody inhibits the activity of this enzyme and prevents the release of proteins from cells. It has been shown to be clinically relevant in treating heart failure, chronic pulmonary disease, and congenital heart disease. In addition, H-Arg-Val-OH acetate salt inhibits the release of inflammatory molecules like interleukin 6 (IL6) and tumor necrosis factor alpha (TNFα), which are involved in a variety of diseases.</p>

<p>Acetate salt</p>

<p>Boc-Arg-Val-Arg-Arg-AMC acetate salt is a protease inhibitor that belongs to the group of basic proteins. It inhibits the action of serine proteases, which are enzymes that break down proteins in cells. Boc-Arg-Val-Arg-Arg-AMC acetate salt has been shown to inhibit leishmania and tumor cell growth. It also inhibits cancer cell proliferation and metastasis. The inhibition of these cancer cell lines by Boc-Arg-Val-Arg-Arg-AMC acetate salt may be due to its ability to inhibit protein synthesis, which is vital for tumor cell growth. Boc Arg Val Arg Arg AMC acetate salt also induces apoptosis (cell death) in some cancer cells through the activation of caspase 3, a cysteine protease that plays an important role in apoptosis signaling pathways.</p>

<p>Please enquire for more information about tert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(Carboxymethyl)-4,5-dimethoxybenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg8)-Vasopressin (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mercuric acetate is a salt of mercuric and acetic acid. It is used as an antiseptic, disinfectant, and preservative in the food industry. Mercuric acetate has been shown to have anti-inflammatory properties and is used for the treatment of inflammatory bowel disease. The ester linkage between the two molecules allows it to be hydrolysed into its components by enzymes such as esterases or glucuronidases, which may be one of the reasons for its therapeutic effects. Mercuric acetate also reacts with biological molecules, including proteins, nucleic acids, and carbohydrates. This reaction mechanism may contribute to its other biological properties such as lowering blood sugar levels and inhibiting glycolysis in cells that depend on sodium-dependent glucose transport mechanisms.</p>

<p>Please enquire for more information about BNP-26 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Aplysia californica is a species of sea slug that produces a peptide, beta-Bag Cell Peptide (BACP), which has been shown to have depolarizing effects on neurons. BACP can be synthesized from the amino acid sequence of the Aplysia californica cell membrane protein, and this synthetic peptide has been shown to have maximal depolarizing effects at high concentrations. The depolarizing effect of BACP can be seen in populations of neurons as well as individual neurons. This peptide also desensitizes autoreceptors for acetylcholine and serotonin, which may play a role in its electrophysiological effects.</p>

<p>5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid is a chemical compound that is used in the formylation of amines to produce formamides. It has been optimized for industrial production by optimizing reaction time, formylation conditions, and solvents. It has also been shown that 5-formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid produces good yields and high product purity.</p>

<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Maleimidophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>

<p>BAM-22P (8-22) trifluoroacetate salt is a compound that has been shown to be an effective drug for the treatment of pain. It has been shown to have an effect on bone cancer, which can be activated by serotonin. This compound may be beneficial in treating nerve injury and fibrosarcoma cells. BAM-22P (8-22) trifluoroacetate salt is an allosteric modulator of the serotonin receptor and may be used as a treatment for pain in wild-type mice. The molecule is also a serotonin reuptake inhibitor, which prevents the reuptake of serotonin into the presynaptic neuron. This leads to increased levels of serotonin in the synapse and increased pain relief.</p>

<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.​</p>

<p>Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>

<p>Please enquire for more information about (2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>

<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>

<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>

<p>4-Aminopicolinic acid is a synthetic amine that has been shown to activate plant science. 4-Aminopicolinic acid is a cyclic peptide with two subunits, one of which is 4-amino-3-pyridinecarboxylic acid. This compound has been synthesized from picolinic acid, an agriculturally important compound that is found in plant and animal tissues. The synthesis of 4-aminopicolinic acid involves the reaction of picolinic acid with nitrous oxide, followed by hydrolysis and oxidation to form the desired product. Hplc analyses have confirmed the presence of picolinic acid in extracts from various plants containing this compound.</p>

<p>Please enquire for more information about Adrenomedullin 5 (primate) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Intermediate in the synthesis of sitagliptin</p>

<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>

<p>Please enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>

<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Androstanolone acetate is a synthetic androgen that has been shown to stimulate the production of testosterone in the testes. Androstanolone acetate has been shown to be effective in treating symptoms of male hypogonadism, as well as erectile dysfunction. The drug also has an antigenic effect, which stimulates the production of antibodies against it. Androstanolone acetate binds to cell specific antigens and stimulates cell proliferation. It has been used in cancer prevention studies, where it was found that it could suppress estrogen-induced endometrial cancer in animals. In addition, Androstanolone acetate is capable of stimulating light emission when incubated with cells and can be detected using chromatographic methods.</p>

<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-(-)-3-Amino-3-phenylpropionic acid is a hydrogenated, stereoselective β-amino acid that is involved in the biosynthesis of animal health. The enzyme acylase catalyzes this reaction by binding with chiral pyridoxal phosphate to form an acylation product. The stereospecificity of the reaction is determined by whether the enzyme has a preference for L or D amino acids. Acylases are found in organisms such as mammals and bacteria.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>

<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>

<p>(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester is an acidic substance that can be produced by the amination of piperazine with chloroacetic acid. The reaction solution is heated to a temperature of about 120°C for about 30 minutes and then cooled to room temperature. The product precipitates as a white solid. This compound has been shown to have antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA) in plates.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sarafotoxin C is a peptide from the venom of the spider Phoneutria nigriventer that has been shown to have potent inhibitory properties on endothelin-1. Sarafotoxin C is able to block intracellular Ca2+ levels and signal pathways, leading to decreased levels of endothelin-1 as well as other inflammatory mediators. Sarafotoxin C has also been shown to have an anti-inflammatory effect in bowel disease, which may be due to its ability to inhibit the production of cytokines and prostaglandins. The biological properties of sarafotoxin C are related to its inhibition of polymerase chain reaction (PCR) amplification of DNA. This inhibition is due to the binding of sarafotoxin C with endothelin receptors on DNA, which prevents DNA polymerase from attaching. Endothelin-a receptor activity can also be inhibited by sarafotoxin C through enzymatic inactivation. Sarafot</p>

<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>