
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Gly-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·C2H4O2Purity:Min. 95%Molecular weight:281.31 g/mol5-Nitro nicotinic acid
CAS:<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formula:C6H4N2O4Purity:Min. 95%Molecular weight:168.11 g/mol4-Hydroxyphenylboronic acid
CAS:<p>4-Hydroxyphenylboronic acid is a potential anticancer agent that has been studied in vitro and in vivo. It has been shown to inhibit the activity of p-glycoprotein, which is a protein that pumps drugs out of cells, and it is also an inhibitor of lipid kinase. 4-Hydroxyphenylboronic acid binds to the ATP binding site of the enzyme and forms covalent bonds with Lys residues on the enzyme, inhibiting its function. The compound can be detected at low concentrations using fluorescence or chemiluminescence techniques. This compound may have therapeutic benefits for antimicrobial agents as well as for cancer treatment.</p>Formula:C6H7BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:137.93 g/molZ-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Z-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H49FN10O6Purity:Min. 95%Molecular weight:676.78 g/molCRAMP (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurity:Min. 95%Molecular weight:1,510.23 g/mol(Tyr9)-β-MSH (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H140N24O30SPurity:Min. 95%Molecular weight:2,202.4 g/molAmyloid β-Protein (1-40) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molZ-Arg-Arg-Arg-4MbetaNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H53N13O6Purity:Min. 95%Molecular weight:775.9 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/mol(D-Phe6,Leu-NHEt 13,des-Met14)-Bombesin (6-14) trifluoroacetate salt
CAS:<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>Formula:C49H69N13O9Purity:Min. 95%Molecular weight:984.15 g/molMca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
<p>Please enquire for more information about Mca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H83N19O12Purity:Min. 95%Molecular weight:1,166.34 g/molH-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H149N31O26SPurity:Min. 95%Molecular weight:2,017.32 g/molc3-Ethylbenzoic acid
CAS:<p>C3-Ethylbenzoic acid is an organic compound that can be synthesized from the reactants ethyl bromide, propylene oxide, and acetic anhydride. The synthesis of C3-Ethylbenzoic acid is a stepwise process in which the starting materials are converted to intermediates and then reacted to form the desired product. The reaction mechanism involves bond cleavage, which generates a carboxylic acid group on one end of the molecule and a phenyl group on the other end. C3-Ethylbenzoic acid interacts with clausamine and isoprene during transport through cell membranes. This interaction may lead to increased permeability of cell membranes by c3-ethylbenzoic acid.</p>Formula:C9H10O2Purity:Min. 95%Molecular weight:150.17 g/molFulvic acid
CAS:<p>Fulvic acid is a natural organic compound that has been used in clinical and biological properties. It is a fluorescent molecule with a high quantum yield, which makes it an ideal candidate for use as a fluorescence probe. Fulvic acid has been shown to form stable complexes with malonic acid, which may be due to the strong hydrogen bonding interactions between these two molecules. The fluorescence emission spectrum of fulvic acid is sensitive to the pH of the reaction solution, and it can be used as a thermodynamic data indicator. Fulvic acid also has low toxicity, which makes it suitable for use in laboratory studies.</p>Formula:C14H12O8Purity:Min. 90%Color and Shape:PowderMolecular weight:308.24 g/molSomatostatin-14 (3-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H96N16O17S2Purity:Min. 95%Molecular weight:1,509.75 g/molN-(tert-Butyloxycarbonyl)-8-amino-3,6-dioxaoctanoic acid
CAS:<p>N-(tert-Butyloxycarbonyl)-8-amino-3,6-dioxaoctanoic acid is a potential drug for hypercholesterolemia. It has been shown to lower LDL cholesterol and triglycerides levels in monkeys. The compound is orally bioavailable and can be taken orally. This drug also has the potential to be developed as a PCSK9 (proprotein convertase subtilisin/kexin type 9) inhibitor.</p>Formula:C11H21NO6Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:263.29 g/molH-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35ClN4O3Purity:Min. 95%Molecular weight:390.95 g/mol(Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid
CAS:<p>Please enquire for more information about (Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H5N3O3SPurity:Min. 95%Molecular weight:187.18 g/mol(S)-(1-boc-pyrrolidin-3-yl)-acetic acid
CAS:<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molNeuropeptide Y (18-36) trifluoroacetate salt
CAS:<p>Neuropeptide Y (18-36) trifluoroacetate salt H-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg -Gln is a peptide belonging to the family of neuropeptides. It has been shown to have potent vasoconstricting activity in rat and guinea pig hearts, as well as contractile activity in rat aortic rings. Neuropeptide Y (18 - 36) trifluoroacetate salt H -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifl uoroacetate salt also inhibits the cyclase activity of adenylate cyclase, which is responsible for generating the second messenger cAMP. This compound may be used to treat congest</p>Formula:C112H174N36O27Purity:Min. 95%Molecular weight:2,456.81 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Formula:C148H239ClN44O42Purity:Min. 95%Molecular weight:3,342.21 g/molH-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N4O4Purity:Min. 95%Molecular weight:260.29 g/molAbz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N17O13Purity:Min. 95%Molecular weight:1,124.25 g/molH-Arg-His-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N8O2Purity:Min. 95%Molecular weight:310.36 g/molBoc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond)
CAS:<p>Please enquire for more information about Boc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H50N8O12S2Purity:Min. 95%Molecular weight:874.98 g/molTRAP-5 trifluoroacetate salt
CAS:<p>TRAP-5 is a peptide consisting of the amino acid sequence H-Ser-Phe-Leu-Leu-Arg. This peptide has been shown to have antiviral, anti-inflammatory, and anticancer properties. It has also been found to inhibit platelet activation in vitro and to reduce atherosclerotic lesions in mice. TRAP-5 has been shown to have therapeutic potential for diseases such as heart disease and lung diseases, although its efficacy has not yet been tested in humans.</p>Formula:C30H50N8O7Purity:Min. 95%Molecular weight:634.77 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H99N19O18S2Purity:Min. 95%Molecular weight:1,414.66 g/mol(D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/molProinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H239N47O46Purity:Min. 95%Molecular weight:3,340.71 g/mol1,3-Dithiane-2-carboxylic acid
CAS:<p>1,3-Dithiane-2-carboxylic acid is an alkylating agent that reacts with electron-deficient substrates. It is a convenient way to access enantiopure carboxylates and unsaturated ketones in the presence of amines. This compound can also be used for the preparation of phthalimides and thioacetals. 1,3-Dithiane-2-carboxylic acid is prepared by ring opening of 1,3 dithianes. This reaction can be catalyzed by acids such as hydrochloric acid or pyridine.</p>Formula:C5H8O2S2Purity:Min. 95%Molecular weight:164.25 g/molHomoterephalic acid
CAS:<p>Homoterephalic acid is a polycarboxylic acid. It has been shown to be effective in the treatment of tumors, and in clinical studies, it has been shown to have anti-cancer activity. Homoterephalic acid inhibits the growth of tumor cells by inhibiting the synthesis of l-glutamic acid. This compound also exhibits anti-inflammatory properties by inhibiting tumor necrosis factor alpha (TNFα) production. Homoterephalic acid is also an inhibitor of human lung diastereomer 1210 cells, as well as erythrocytes infected with L1210 leukemia cells. Homoterephalic acid is a substrate for glycinamide ribonucleotide synthetase and can be used for the biosynthesis of thymidylate. It can be used for the synthesis of polycarboxylic acids that are important for cell metabolism and protein synthesis.</p>Formula:C11H12O4Purity:Min. 95%Molecular weight:208.21 g/molAminocaproic acid
CAS:<p>Aminocaproic acid is a non-specific lysing agent that is used in the treatment of acute blood clots. Aminocaproic acid has minimal toxicity and low-dose effects, and can be used for the treatment of thrombotic disorders. It also has biological properties that are different from those of aminocaproate, which can lead to a more rapid dissolution of the clot. Aminocaproic acid is an organic compound that belongs to the class of dicarboxylic acids. It is synthesized from two molecules of aminoacetic acid by the enzyme aminocaproic acid synthetase. The synthesis occurs in a two-step process: first, caprylic acid reacts with ATP to form aminopropyl-adenylate (APA), followed by hydrolysis by APA lyase to form aminocaproic acid.</p>Formula:C6H13NO2Color and Shape:PowderMolecular weight:131.17 g/molDynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/moltert-Butyl oxazol-5-ylcarbamate
CAS:<p>Please enquire for more information about tert-Butyl oxazol-5-ylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12N2O3Purity:Min. 95%Molecular weight:184.19 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/mol5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H138N34O18Purity:Min. 95%Molecular weight:1,972.27 g/mol(Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H210N42O45Purity:Min. 95%Molecular weight:3,261.47 g/molAPL1b27 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H174N30O38SPurity:Min. 95%Molecular weight:2,472.73 g/molα-Conotoxin MI trifluoroacetate salt
CAS:Controlled Product<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>Formula:C58H88N22O17S4Purity:Min. 95%Molecular weight:1,493.72 g/mol(D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H99N19O15Purity:Min. 95%Molecular weight:1,338.56 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS:<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H37N5O4•3C2H4O2Purity:Min. 95%Molecular weight:567.67 g/mol(Pyr 1)-Opiorphin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H45N11O8Purity:Min. 95%Molecular weight:675.74 g/mol4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester
CAS:<p>Please enquire for more information about 4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H23ClN2O3Purity:Min. 95%Molecular weight:374.86 g/moltert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18BrNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:312.2 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H159N25O32S5·C2HF3O2Purity:Min. 95%Molecular weight:2,605.93 g/molAcetyl-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C186H284N50O61SPurity:Min. 95%Molecular weight:4,228.61 g/molH-Leu-Trp-Met-Arg-Phe-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-OH acetate salt is a molecule that transports amino acids across the cell membrane of bacteria, preventing bacterial growth. It is produced by proctolin and functional groups in dental plaque. This compound has been shown to inhibit the growth of bacteria in vitro by binding to hypochlorous acid, which is part of the antimicrobial activity of human neutrophils. H-Leu-Trp-Met-Arg-Phe-OH acetate salt has been used as a tracer for studying amino acid transport in E. coli cells and its uptake into extracellular vesicles. The product can also be used as an antiplaque agent due to its ability to inhibit the acid transport system and uptake of amino acids from the environment.</p>Formula:C37H53N9O6SPurity:Min. 95%Molecular weight:751.94 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>The Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a biologically active form of arginine. It has been shown to inhibit the activity of both NS3 protease and NS4A protease from the hepatitis C virus (HCV). It also inhibits tumor cell growth in vitro, which may be due to its ability to upregulate epidermal growth factor receptor (EGFR) expression on tumor cells. The Arg-Arg-Arg-Arg-Arg-Arg-Arghydrogen trifluoroacetate salt is an inhibitor of estrogen receptor modulators that are used as therapeutic agents for breast cancer.</p>Formula:C42H86N28O8Purity:Min. 95%Molecular weight:1,111.32 g/molMca-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H129N27O28SPurity:Min. 95%Molecular weight:2,033.19 g/mol(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H60N10O8Purity:Min. 95%Molecular weight:796.96 g/mol2-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/molpTH (7-84) (human) trifluoroacetate salt
<p>Please enquire for more information about pTH (7-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C381H629N119O115S2Purity:Min. 95%Molecular weight:8,780.94 g/molDnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt
<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H64N14O12SPurity:Min. 95%Molecular weight:965.09 g/mol6-Chloro-2-methylbenzoic acid
CAS:<p>6-Chloro-2-methylbenzoic acid is a methyl ester that is used in the synthesis of 2-chloro-6-fluorobenzaldehyde. This chemical reacts with hydrogen peroxide to produce chloride and 2,6-dichlorobenzoic acid. The compound can also be synthesized from 2,6-dichlorobenzaldehyde and methoxyethanol. 6CMB has been shown to react with anions such as Cl-, Br-, NO2-, SO3H, and PO3H2 to form organic carboxylates or sulfoxides. It has also been shown to be a byproduct of the reaction between chloral hydrate and potassium permanganate.</p>Formula:C8H7ClO2Purity:90%Color and Shape:PowderMolecular weight:170.59 g/molMyeloblastin (142-150) (human, mouse) trifluoroacetate salt
CAS:<p>Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr-Val-OH trifluoroacetate salt is an antigen that belongs to the class of serine proteinases. It is a soluble recombinant human proteinase that has been shown to have a tumor cell lysis activity in vitro and in vivo. Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr Val is also a leukocyte antigen and can be used for the development of cancer vaccines.</p>Formula:C45H79N11O15Purity:Min. 95%Molecular weight:1,014.17 g/mol3-Fluoro-2-nitrobenzoic acid
CAS:<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molEnterotoxin STp (E. coli) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H110N20O26S6Purity:Min. 95%Molecular weight:1,972.26 g/molD-Aspartic acid
CAS:<p>D-Aspartic acid is a basic protein that binds to glutamate. It has been shown to be effective in the prevention and treatment of bone cancer in mice. D-Aspartic acid also has an inhibitory effect on the production of estradiol benzoate, which is an enzyme responsible for bone resorption. D-Aspartic acid may also be used as a dietary supplement for bowel disease and bowel motility.<br>D-Aspartic acid has been shown to have receptor activity in humans and to have physiological effects on the locomotor activity of rats. The complex enzyme d-aspartate oxidase can be inhibited by d-aspartic acid.</p>Formula:C4H7NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:133.1 g/mol3-Bromopropylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 3-Bromopropylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18BBrO2Purity:Min. 95%Molecular weight:248.95 g/molL(+)-2,3-Diaminopropionic acid HCl
CAS:<p>L(+)-2,3-Diaminopropionic acid HCl is a chiral modifier that is used in the separation of organic compounds. It has been shown to selectively interact with borate, sulfate, and hydroxyapatite. This interaction changes the physical properties of these substances by modifying their surface charge or adsorption capacity. L(+)-2,3-Diaminopropionic acid HCl has also been shown to be useful in diastereoselective reactions. The technique of elution can be used to isolate specific compounds from mixtures using this compound as a modifier. Hydrogen bonding groups and moieties on the functional group are important factors in the specificity of this interaction.END>></p>Formula:C3H8N2O2·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:140.57 g/molThymosin α1 acetate
CAS:<p>Thymalfasin is a peptide that belongs to the thymosin family. It is a biocompatible polymer with a number of biomedical applications, including as a component in wound dressings and anti-adhesive agents. Thymalfasin has been shown to be effective at inhibiting the replication of influenza A virus, which may be due to its ability to bind to toll-like receptor 4 (TLR4). This drug also has antitumor properties and has been shown to stimulate the production of IL-2 receptor in human monocytes. Thymalfasin also inhibits the growth of cancer cells, such as HL60 cells, by blocking DNA synthesis. The molecular weight of this compound is approximately 20-30 kDa.</p>Formula:C129H215N33O55•(C2H4O2)xPurity:Min. 95%Molecular weight:3,108.28 g/mol3-(4-Fluorobenzoyl)propionic acid
CAS:<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>Formula:C10H9FO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:196.18 g/mol4-Fluoro-2-(trifluoromethyl)phenylboronic acid
CAS:<p>The process development of 4-fluoro-2-(trifluoromethyl)phenylboronic acid (4FTFPBA) is a simplified procedure that can be scaled up and used for medicinal chemistry. This compound was synthesized by a boronic acid process using the Suzuki-Miyaura cross coupling reaction. The major factor to consider in this synthesis is the placement of the fluorine atom, which determines the relative reactivity and stability of the compound. In order to mimic these factors, an environment with low water content and a sequence that minimizes exposure to air are required.</p>Formula:C7H5BF4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:207.92 g/molPropanedioic acid 1-methyl ester
CAS:<p>Propanedioic acid 1-methyl ester (PDM) is a synthetic trifluoroacetic acid ester of the natural fatty acid, propanedioic acid. It has been found to be a potent inhibitor of the enzyme malonic acid decarboxylase in vitro and has also been shown to inhibit the production of prostaglandin E2 in mice with adjuvant arthritis. PDM is used as a diagnostic agent for autoimmune diseases and inflammatory diseases. It is also being studied as an anti-inflammatory drug for use in the treatment of chronic inflammatory conditions such as rheumatoid arthritis, psoriasis, and ulcerative colitis. The mechanism of action is not well understood but may involve inhibition of arachidonic acid metabolism or inhibition of cyclooxygenase enzymes.</p>Formula:C4H6O4Purity:Min. 95%Color and Shape:Colourless To Pale Yellow Clear LiquidMolecular weight:118.09 g/molNeuropeptide EI (human, mouse, rat) trifluoroacetate salt
CAS:<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>Formula:C63H98N16O23Purity:Min. 95%Molecular weight:1,447.55 g/mol(D-His2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/mol(Deamino-Cys1,b-(3-pyridyl)-D-Ala2,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.</p>Formula:C45H63N15O11S2Purity:Min. 95%Molecular weight:1,054.21 g/molMethyl 6-oxo-1,6-dihydropyridazine-3-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-oxo-1,6-dihydropyridazine-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6N2O3Purity:Min. 95%Molecular weight:154.12 g/mol(Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H79N15O10Purity:Min. 95%Molecular weight:1,098.3 g/molBradykinin (1-7) acetate salt
CAS:<p>Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt is a synthetic peptide that was designed to simulate the activity of bradykinin. It has been shown to be effective in the treatment of angina pectoris and as an analgesic. This peptide can also be used in the analysis of carboxypeptidase activity, by adding it to homogenates and measuring the reaction products. Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt can also be used to analyze salivary glands, activated erythrocytes, and silicon wafers. It is particularly useful for examining morphology and nanowires.</p>Formula:C35H52N10O9Purity:Min. 95%Molecular weight:756.85 g/molBNP-26 (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-26 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H198N42O36S2Purity:Min. 95%Molecular weight:2,869.25 g/molAmyloid β-Protein (1-15) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (1-15) is a peptide fragment of the amyloid protein that is associated with Alzheimer's disease. Amyloid beta-Protein (1-15) activates the transcription of a number of genes, including those that encode neurotrophic factors and growth factors. It has been shown to have neurotrophic properties and to increase the survival rate of neurons in vitro. It also protects against neuronal death induced by oxidative stress and high concentrations of glutamate. The structure of amyloid beta-protein (1-15) has been elucidated using molecular modeling techniques and X-ray crystallography. The trifluoroacetate salt form is stable at physiological pH levels and shows good solubility in water, making it an attractive therapeutic drug candidate.</p>Formula:C78H107N25O27Purity:Min. 95%Molecular weight:1,826.84 g/molVIP (6-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP (6-28) (human, mouse, rat) trifluoroacetate salt H-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys -Lys-Tyr-Leu is a prophylactic agent that is used to prevent the development of intestinal peptide induced myocardial fibrosis. It has been shown to reduce the incidence and severity of cardiovascular diseases. VIP (6/28) has a vasoactive effect on the intestines and may also have an effect on the cardiovascular system.</p>Formula:C126H207N37O34SPurity:Min. 95%Molecular weight:2,816.29 g/molβ-Bag Cell Peptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Aplysia californica is a species of sea slug that produces a peptide, beta-Bag Cell Peptide (BACP), which has been shown to have depolarizing effects on neurons. BACP can be synthesized from the amino acid sequence of the Aplysia californica cell membrane protein, and this synthetic peptide has been shown to have maximal depolarizing effects at high concentrations. The depolarizing effect of BACP can be seen in populations of neurons as well as individual neurons. This peptide also desensitizes autoreceptors for acetylcholine and serotonin, which may play a role in its electrophysiological effects.</p>Formula:C33H53N13O6Purity:Min. 95%Molecular weight:727.86 g/mol5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid
CAS:<p>5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid is a chemical compound that is used in the formylation of amines to produce formamides. It has been optimized for industrial production by optimizing reaction time, formylation conditions, and solvents. It has also been shown that 5-formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid produces good yields and high product purity.</p>Formula:C8H9NO3Purity:Min. 95%Molecular weight:167.16 g/molBoc-trans-4-aminocyclohexane acetic acid
CAS:<p>Please enquire for more information about Boc-trans-4-aminocyclohexane acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO4Molecular weight:257.33 g/mol1-Pyridin-2-ylmethylpiperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-Pyridin-2-ylmethylpiperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O2Purity:Min. 95%Molecular weight:220.27 g/mol4-Chlorophenylboronic acid
CAS:<p>4-Chlorophenylboronic acid is a chemical compound that is used in the industrial preparation of biphenyl. It is produced by the Friedel-Crafts reaction between chlorine and 4-methoxyphenylboronic acid. This reaction can be carried out using a variety of solvents, such as chloroform or carbon tetrachloride. The optimal reaction conditions are acidic pH values, which are achieved by adding sodium carbonate to the solution. The product can be purified by distillation or crystallization. 4-Chlorophenylboronic acid can also be used for the synthesis of organic compounds through cross-coupling reactions with organometallic reagents, such as palladium chloride and triphenylphosphine, or through asymmetric synthesis with chiral ligands like (S)-proline and 2-(diphenylphosphino)ferrocene.</p>Formula:C6H6BClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:156.37 g/molAcetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N32O21Purity:Min. 95%Molecular weight:2,240.7 g/mol(D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H106N22O12Purity:Min. 95%Molecular weight:1,375.67 g/molDSP
CAS:<p>DSP is a widely used disulfide crosslinker in ADC synthesis. It forms reversible conjugates via intracellular reduction, enabling payload release.</p>Formula:C14H16N2O8S2Purity:Min. 95%Color and Shape:SolidMolecular weight:404.42 g/molHIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H79N11O14S2Purity:Min. 95%Molecular weight:1,050.3 g/mol3-Methylbenzofuran-2-carboxylic acid
CAS:<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:176.17 g/molCyclopropane-1,1-dicarboxylic acid, methylester
CAS:<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:144.13 g/mol4-Hydroxy-1,3-benzenedisulfonic acid
CAS:<p>4-Hydroxy-1,3-benzenedisulfonic acid (4HBDS) is a reactive molecule that is used as a model system for the study of chain reactions. 4HBDS does not undergo hydrolysis or oxidation and is stable in water. It can be prepared by the reaction of nitrate with acetate extract and has been shown to react with diazonium salts to form an analytical method for nitrite ion. 4HBDS reacts with hydrochloric acid to generate proton and significant interactions are observed at pH values between 1 and 3.</p>Purity:Min. 95%5,7-Dimethyl-[1,2,4]triazolo[1,5-a]pyrimidine-2-carboxylic acid
CAS:<p>Please enquire for more information about 5,7-Dimethyl-[1,2,4]triazolo[1,5-a]pyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8N4O2Purity:Min. 95%Molecular weight:192.17 g/molH-Val-Lys-Lys-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H47N9O5Purity:Min. 95%Molecular weight:529.68 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/mol(Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H108N22O12Purity:Min. 95%Molecular weight:1,401.7 g/mol(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/mol3-Pyridineboronic acid
CAS:<p>3-Pyridineboronic acid is an antimicrobial agent that is used to treat bacterial and fungal infections. 3-Pyridineboronic acid is a prodrug that is metabolized to its active form, pyridinium boronate. This drug has been shown to be effective in the treatment of hypoxic tumors in mice, which are resistant to other anticancer drugs. 3-Pyridineboronic acid also has acidic properties and can be used as an antiseptic for the treatment of skin and eye infections. It can also be used as a hydrogen bonding partner when combined with halides, such as chloride or bromide ions. The drug binds to human serum proteins and forms an acidic complex that prevents bacterial growth by inhibiting protein synthesis. 3-Pyridineboronic acid also inhibits prostate cancer cells by competitively inhibiting the enzyme 4-pyridinylboronic acid reductase (4PBAR).</p>Formula:C5H6BNO2Purity:Min. 95%Molecular weight:122.92 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS:<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.</p>Formula:C7H10N2O4•HBrPurity:Min. 95%Molecular weight:267.08 g/molGLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H273N51O57Purity:Min. 95%Molecular weight:4,111.45 g/mol(2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid
CAS:<p>Please enquire for more information about (2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H8FNO2Purity:Min. 95%Molecular weight:133.12 g/molHIV (gp120) Fragment (421-438) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H148N24O25S2Purity:Min. 95%Molecular weight:2,138.51 g/molpTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C186H313N53O44S2Purity:Min. 95%Molecular weight:4,059.94 g/molUrocortin III (mouse) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C186H312N52O52S2Purity:Min. 95%Molecular weight:4,172.92 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molH-Gly-Gly-Lys-Arg-OH acetate salt
CAS:<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>Formula:C16H32N8O5Purity:Min. 95%Molecular weight:416.48 g/mol4-Aminopicolinic acid
CAS:<p>4-Aminopicolinic acid is a synthetic amine that has been shown to activate plant science. 4-Aminopicolinic acid is a cyclic peptide with two subunits, one of which is 4-amino-3-pyridinecarboxylic acid. This compound has been synthesized from picolinic acid, an agriculturally important compound that is found in plant and animal tissues. The synthesis of 4-aminopicolinic acid involves the reaction of picolinic acid with nitrous oxide, followed by hydrolysis and oxidation to form the desired product. Hplc analyses have confirmed the presence of picolinic acid in extracts from various plants containing this compound.</p>Formula:C6H6N2O2Purity:Min. 95%Color and Shape:White To Beige Or Pink To Light Brown SolidMolecular weight:138.12 g/mol1-Methylpiperidine-4-carboxylic acid hydrochloride
CAS:<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>Formula:C7H14NO2ClPurity:Min. 95%Molecular weight:179.64 g/molDiisopropyl azodicarboxylate - 40% toluene solution
CAS:<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>Formula:C8H14N2O4Purity:Min. 95%Color and Shape:Yellow To Yellow Orange LiquidMolecular weight:202.21 g/mol(D-Trp8)-γ2-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/mol(Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H203N37O30SPurity:Min. 95%Molecular weight:2,796.3 g/molH-Gly-Gly-Lys-Ala-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N6O6Purity:Min. 95%Molecular weight:402.45 g/molEthyl 4-methoxyphenylacetate
CAS:<p>Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.</p>Formula:C11H14O3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:194.23 g/molTert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate
CAS:<p>Please enquire for more information about Tert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO3Purity:Min. 95%Molecular weight:241.33 g/molZ-Val-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H36N8O7Purity:Min. 95%Molecular weight:584.62 g/mol(D-Ser6,Azagly10)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Ser6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H76N18O14Purity:Min. 95%Molecular weight:1,213.3 g/molCecropin B (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H301N51O42SPurity:Min. 95%Molecular weight:3,835.66 g/molH-Met-AMC acetate salt
CAS:<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H18N2O3SPurity:Min. 95%Molecular weight:306.38 g/molConjugated linoleic acid - liquid
CAS:<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>Formula:C18H32O2Purity:Min. 95%Color and Shape:Slightly Yellow Clear LiquidMolecular weight:280.45 g/mol3-Piperidin-1-ylpropanoic acid
CAS:<p>3-Piperidin-1-ylpropanoic acid is a hydroxylated compound that belongs to the group of aromatic hydrocarbons. It has been shown to inhibit the activity of enzymes such as model studies and test compounds, which are used in biological samples. 3-Piperidin-1-ylpropanoic acid is not active against mouse tumor cells and does not show any locomotor activity. The terminal half life of this drug has been determined in urine samples from mice at 20 hours.</p>Formula:C8H15NO2Purity:Min. 95%Molecular weight:157.21 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/mol3-Hydroxy-3-methylglutaric acid
CAS:<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>Formula:C6H10O5Purity:Min. 95%Molecular weight:162.14 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/molAdropin (34-76) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H293N55O68S2Purity:Min. 95%Molecular weight:4,499.82 g/mola-(Trichloromethyl)benzyl acetate
CAS:<p>a-(Trichloromethyl)benzyl acetate is an organic compound with the formula CHClCOCH. It is a colorless liquid which is soluble in organic solvents. This compound exhibits oxidative carbonylation activity, and has been shown to be used for the coating of particles, detergent compositions, and analytical methods. The microcapsules are prepared by encapsulating a fatty acid in a glycol ether. The health effects of this compound are not well understood but it is believed that it may have some carcinogenic properties.</p>Formula:C10H9Cl3O2Purity:Min. 95%Molecular weight:267.54 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/mol4-Hydroxyphenyl acetate
CAS:<p>4-Hydroxyphenyl acetate is a naturally occurring fatty acid that is found in many plants. It has been isolated from the seeds of Telfairia occidentalis and has been shown to inhibit the growth of bacteria at a pH of 7.5, with an optimal pH of 8.0. 4-Hydroxyphenyl acetate is an activated form of this compound, which means it contains two hydroxyl groups and does not have to be synthesized by enzymes. 4-Hydroxyphenyl acetate inhibits bacterial enzyme activities such as DNA gyrase and RNA polymerase, which are necessary for transcription and replication. The structure analysis of 4-hydroxy phenylacetate was determined using trifluoroacetic acid (TFA) on a wild-type strain of Escherichia coli K12.</p>Formula:C8H8O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:152.15 g/molTRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/mol(DL-Isoser 1)-TRAP-6 trifluoroacetate salt
CAS:<p>Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molH-Arg-Phe-OH acetate salt
CAS:<p>H-Arg-Phe-OH Acetate Salt is a peptide that has the amino acids H, Arg, Phe and OH. It is a stable complex with amines and is effective in reducing blood pressure. The binding constants are high, which means that it can be used as an antihypertensive agent. A study on the haemodynamic effects of H-Arg-Phe-OH Acetate Salt showed that it could inhibit the release of noradrenaline levels in the body. The reaction mechanism for H-Arg-Phe-OH Acetate Salt is functional groups plus fatty acids; kidney bean is one of its sources.</p>Formula:C15H23N5O3Purity:Min. 95%Molecular weight:321.38 g/molpTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H317N63O53Purity:Min. 95%Molecular weight:4,416.02 g/mol(Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%MAGE-1 Antigen (161-169) (human) acetate salt
CAS:<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>Formula:C41H57N11O17Purity:Min. 95%Molecular weight:975.96 g/molCART (55-102) (human) trifluoroacetate salt
CAS:<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>Formula:C225H365N65O65S7Purity:Min. 95%Molecular weight:5,245.17 g/moltert-Butyl carbamate
CAS:<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:117.15 g/molNeurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H52N8O12Purity:Min. 95%Molecular weight:776.83 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H73N13O26Purity:Min. 95%Molecular weight:1,344.25 g/mol(D-Lys6)-LHRH (free acid) acetate salt
CAS:Controlled Product<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H83N17O14Purity:Min. 95%Molecular weight:1,254.4 g/molCART (61-102) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H310N58O56S7Purity:Min. 95%Molecular weight:4,515.3 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molα-Casein (90-96) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H64N10O12Purity:Min. 95%Molecular weight:913.03 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/mol2,5-Anhydro-3,4-dideoxy-erythro-hexaric acid - 98%
CAS:<p>The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated until</p>Formula:C6H8O5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:160.12 g/mol1-Methyl-1-cyclohexanecarboxylic acid
CAS:<p>1-Methyl-1-cyclohexanecarboxylic acid is a fatty acid that is present in the conjugates of natural and synthetic oils. It is an unsaturated fatty acid with a cycloalkane ring structure. The synthesis of 1-methyl-1-cyclohexanecarboxylic acid has been shown to be catalyzed by a carboxylase, which converts acetyl CoA into malonyl CoA. This reaction is irreversible and can be used as the first step in the biosynthesis of fatty acids. 1-Methyl-1-cyclohexanecarboxylic acid has been shown to cause cell death in leukemia cells, as well as inhibit epileptic seizures in rats.</p>Formula:C8H14O2Purity:Min. 95%Molecular weight:142.2 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H216N42O45Purity:Min. 95%Molecular weight:3,183.45 g/mol5-Phenylisoxazole-3-carboxylic acid
CAS:<p>5-Phenylisoxazole-3-carboxylic acid is a phenoxy compound that has been shown to inhibit the growth of tuberculosis bacteria. This drug binds to the postsynaptic potential in the cell membrane and inhibits the effector proteins from interacting with the receptor, preventing neurotransmitter release. The molecular modeling study showed that 5-Phenylisoxazole-3-carboxylic acid interacts with ethyl esters and rifampin, which inhibits xanthine oxidase. Xanthine oxidase inhibitors are used as a treatment for gout and hyperuricemia. 5-Phenylisoxazole-3-carboxylic acid also has fluorimetric properties, which can be used to measure its concentration in biological samples such as urine or plasma. Nitro groups in this drug make it susceptible to oxidation by nitric oxide, which can be monitored using nmr spectra.</p>Formula:C10H7NO3Purity:Min. 95%Molecular weight:189.17 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H279N55O46SPurity:Min. 95%Molecular weight:4,017.58 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molN,N'-Dibenzylethylenediamine diacetate
CAS:Controlled Product<p>N,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.</p>Formula:C16H20N2•(C2H4O2)2Purity:Min. 95%Molecular weight:360.45 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/molPACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H300N56O45SPurity:Min. 95%Molecular weight:4,024.75 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H116N20O19SPurity:Min. 95%Molecular weight:1,657.93 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H79N13O12S2Purity:Min. 95%Molecular weight:1,034.3 g/molH-Ala-Gly-Tyr-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Ala-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molH-Glu-Gly-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N8O7Purity:Min. 95%Molecular weight:480.48 g/molBNP-45 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-45 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C209H354N70O63S2Purity:Min. 95%Molecular weight:4,919.61 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS:<p>Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H14NNaO6SPurity:Min. 95%Molecular weight:323.3 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H73N11O16SPurity:Min. 95%Molecular weight:1,080.21 g/mol(2S)-β-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate
CAS:Controlled Product<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>Formula:C21H33N5O5Purity:Min. 95%Molecular weight:435.52 g/mol5-Formyltetrahydropteroic acid
CAS:<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>Formula:C15H16N6O4Purity:Min. 95%Molecular weight:344.33 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/mol(D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H72N14O12Purity:Min. 95%Molecular weight:1,085.22 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/molFmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid
CAS:<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>Formula:C23H27NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:397.46 g/mol2-Nitrobenzaldiacetate
CAS:<p>2-Nitrobenzaldiacetate is a chemical compound that has been used as a reaction component and reagent. It is also useful for the synthesis of other compounds. 2-Nitrobenzaldiacetate is a high quality, versatile building block that can be used to make complex compounds. The CAS number for this chemical is 6345-63-7. This compound has been shown to have many uses in research, such as being a useful intermediate or building block in synthetic organic chemistry.</p>Formula:C11H11NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:253.21 g/molGly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C146H234N46O52Purity:Min. 95%Molecular weight:3,465.7 g/mol3-Amino-4-fluorobenzoic acid
CAS:<p>3-Amino-4-fluorobenzoic acid is a hydrocarbon that is used as an analgesic. It has been shown to be nontoxic and has analgesic effects in the intestinal tract. 3-Amino-4-fluorobenzoic acid also has radiopaque properties, which makes it useful for diagnosis and treatment of certain types of cancer and other tumors. The analgesic effect of 3-amino-4-fluorobenzoic acid may be due to its ability to act as a competitive antagonist at the N -methyl--aspartate (NMDA) receptor, which is important in pain perception.</p>Formula:C7H6FNO2Purity:Min. 95%Molecular weight:155.13 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molHemimellitic acid
CAS:<p>Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).</p>Formula:C9H6O6Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:210.14 g/molDynorphin A (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H127N25O14Purity:Min. 95%Molecular weight:1,602.97 g/mol3-Hydroxy-4-methyl-2-nitro-benzoic acid
CAS:<p>3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.</p>Purity:Min. 95%(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid
CAS:<p>(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is an antibacterial agent that inhibits the enzyme acetylcholine esterase. This inhibition prevents the breakdown of acetylcholine, leading to increased levels of this neurotransmitter in the brain and an enhancement of cholinergic transmission. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid has been shown to be effective against bacterial strains resistant to β-lactam antibiotics. The synthesis of taxol as well as other β-amino acids has been demonstrated using a variety of enzymatic methods. A reaction scheme for the synthesis of nicotinic acetylcholine has also been proposed. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is a dipept</p>Formula:C10H10F3NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:233.19 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS:<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>Formula:C17H18O3Purity:Min. 95%Molecular weight:270.32 g/molLIP2 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H288N58O58Purity:Min. 95%Molecular weight:4,240.61 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H72N14O8Purity:Min. 95%Molecular weight:1,081.27 g/molDocosahexaenoic acid ethyl ester
CAS:<p>Docosahexaenoic acid ethyl ester (DHAEE) is a biologically active form of docosahexaenoic acid (DHA), which is an omega-3 polyunsaturated fatty acid. DHAEE is synthesized from DHA through the process of acylation with ethanol. It has been shown to have antioxidant and anti-inflammatory properties in animal studies, as well as improved brain functions. When given to rats, it prevents neuronal death and has been shown to reduce the risk of congestive heart failure.</p>Formula:C24H36O2Purity:Min. 95%Color and Shape:Colorless Yellow Clear LiquidMolecular weight:356.54 g/molL-Lysine acetate
CAS:Controlled Product<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>Formula:C8H18N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.24 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/molRANTES (human) trifluoroacetate salt
<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C350H534N96O100S5Purity:Min. 95%Molecular weight:7,846.9 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/mol4-(Trimethylsilyl)pheNylboroNic acid
CAS:<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>Formula:C9H15BO2SiPurity:Min. 95%Molecular weight:194.11 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/molAmyloid β/A4 Protein Precursor770 (394-410) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (394-410) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H151N31O26S2Purity:Min. 95%Molecular weight:2,099.44 g/molGalanin Message Associated Peptide (1-41) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C206H326N56O64SPurity:Min. 95%Molecular weight:4,643.2 g/mol(Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H83N13O14Purity:Min. 95%Molecular weight:1,042.23 g/molFmoc-L-glutamic acid γ-methyl ester
CAS:<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21NO6Purity:Min. 95%Molecular weight:383.39 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/mol(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C208H308N54O61SPurity:Min. 95%Molecular weight:4,573.06 g/molNeuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H180N32O38Purity:Min. 95%Molecular weight:2,558.8 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/mol2,6-Dichloro-5-fluoronicotinic acid
CAS:<p>2,6-Dichloro-5-fluoronicotinic acid (2,6-DCFNA) is a chlorinating agent that is activated in acidic solutions. It is used to produce the disinfectant peracetic acid and in the industrial process of producing phenol. 2,6-DCFNA reacts with chloride to form hypochlorous acid (HOCl), which causes inflammation in cells by activating inflammatory cells such as neutrophils and macrophages. 2,6-DCFNA also inhibits tyrosine kinase activity, which may contribute to its anti-inflammatory properties. The toxic effects of 2,6-DCFNA have been studied on hematopoietic cells in vitro. Studies show that this compound can cause apoptosis or death of these cells and may be useful for the treatment of inflammatory diseases such as rheumatoid arthritis. 2,6-DCFNA has also been shown to inhibit tumor growth when</p>Formula:C6H2Cl2FNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:209.99 g/molLys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>Formula:C47H75N13O11Purity:Min. 95%Molecular weight:998.18 g/mol
