
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
β-Casomorphin (1-4) (bovine) acetate salt
CAS:<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>Formula:C28H34N4O6Purity:Min. 95%Molecular weight:522.59 g/molH-Lys-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N6O5Purity:Min. 95%Molecular weight:388.46 g/molDnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H64N14O11Purity:Min. 95%Molecular weight:977.08 g/molAmyloid β-Protein (1-40) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molPAR-2 (1-6) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molAnnexin A1 (1-11) (dephosphorylated) (human, bovine, chicken, porcine) trifluoroacetate salt
CAS:<p>Annexin A1 (1-11) is a peptide that is part of the annexin family. It is involved in the degranulation of cells and inhibits inflammation by inhibiting the production of pro-inflammatory cytokines. Annexin A1 (1-11) has been shown to be an anti-inflammatory compound as it binds to phospholipids on the surface of neutrophils, leading to inhibition of their chemotaxis and phagocytosis. This peptide also interacts with other annexins and prevents apoptosis by blocking caspase activity. Finally, it has been found that annexin A1 (1-11) can promote the healing of wounds in mice by accelerating reepithelialization and reducing scar formation. The concentration required for these effects are nanomolar concentrations.</p>Formula:C63H94N14O17SPurity:Min. 95%Molecular weight:1,351.57 g/mol(Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H79N15O10Purity:Min. 95%Molecular weight:1,098.3 g/molγ-Polyglutamic acid sodium - MW 800-1500
CAS:<p>Polymer of glutamic acid</p>Formula:(C5H9NO3)nPurity:Min. 95%Color and Shape:PowderDibenzoyl-D-(+)-tartaric acid monohydrate
CAS:<p>Dibenzoyl-D-(+)-tartaric acid monohydrate is a weak organic acid that can be used as a neutralizing agent. It has been shown to react with hydrochloric acid, calcium carbonate, and other inorganic acids to form water soluble salts. This compound is also useful for the separation of enantiomers in chromatography and for the determination of the rate of reaction between an organic molecule and an inorganic acid. Dibenzoyl-D-(+)-tartaric acid monohydrate has been used as a template molecule for determining thermodynamic data on various molecules.</p>Formula:C18H14O8·H2OPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:376.31 g/mol4-(2'-N-Boc-hydrazino)benzoic acid
CAS:<p>Please enquire for more information about 4-(2'-N-Boc-hydrazino)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/molN-α-Boc-Nβ-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,3-diaminopropionic acid
CAS:<p>Please enquire for more information about N-alpha-Boc-Nbeta-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N2O6Purity:Min. 95%Molecular weight:368.42 g/molAmyloid β-Protein (1-15) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (1-15) is a peptide fragment of the amyloid protein that is associated with Alzheimer's disease. Amyloid beta-Protein (1-15) activates the transcription of a number of genes, including those that encode neurotrophic factors and growth factors. It has been shown to have neurotrophic properties and to increase the survival rate of neurons in vitro. It also protects against neuronal death induced by oxidative stress and high concentrations of glutamate. The structure of amyloid beta-protein (1-15) has been elucidated using molecular modeling techniques and X-ray crystallography. The trifluoroacetate salt form is stable at physiological pH levels and shows good solubility in water, making it an attractive therapeutic drug candidate.</p>Formula:C78H107N25O27Purity:Min. 95%Molecular weight:1,826.84 g/molD,L-Mevalonic acid lactone
CAS:<p>Mevalonic acid lactone is a natural compound that has been shown to have an effect on mitochondrial membrane potential. It has also been shown to inhibit the drug transporter P-glycoprotein, which is involved in the transport of drugs out of cells. Mevalonic acid lactone has also demonstrated an anti-inflammatory effect, as it inhibits the production of TNF-α and IL-6 in human serum. This compound also possesses antioxidant properties, which may be due to its hydroxyl group and phenoxy groups. Mevalonic acid lactone can be used as a model system for sesquiterpene lactones, and it is able to improve mitochondrial functions by inhibiting pyrazole ring formation.</p>Formula:C6H10O3Purity:Min. 95%Color and Shape:PowderMolecular weight:130.14 g/molOzarelix acetate salt
CAS:<p>Ozarelix acetate salt is a synthetic androgen that has been shown to have pharmacological activity in the treatment of prostate cancer. It binds to albumin, which is found in high concentrations in the prostate, and is then released slowly over time. In rat studies, it has been shown to improve symptoms of depression by binding to serotonin receptors. This drug also binds with fatty acids in blood plasma and can be used as a biomarker for the presence of cancer. Ozarelix acetate salt has not been studied extensively in humans, but has shown promising results when used for the treatment of diabetic neuropathy and for cancer prevention.</p>Formula:C72H96ClN17O14Purity:Min. 95%Molecular weight:1,459.09 g/molH-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.</p>Formula:C21H31ClN6O3Purity:Min. 95%Molecular weight:450.96 g/mol3-(2-Cyanopropan-2-yl)benzoic acid
CAS:<p>Please enquire for more information about 3-(2-Cyanopropan-2-yl)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2Purity:Min. 95%Molecular weight:189.21 g/molCART (62-76) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (62-76) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H99N17O23S3Purity:Min. 95%Molecular weight:1,570.77 g/molN-Methyliminodiacetic Acid
CAS:<p>N-Methyliminodiacetic acid is a monosodium salt that is produced by the reaction of methylamine and malonic acid. It has been shown to have an inhibitory effect on enzymes and metabolic rates in the human body. The structure of N-methyliminodiacetic acid contains a hydroxyl group, which can form hydrogen bonding interactions with nitrogen atoms in proteins, forming a chelate ligand. This type of binding is thought to be responsible for its ability to inhibit enzyme activities and metabolic rate.</p>Formula:C5H9NO4Purity:Min. 95%Molecular weight:147.13 g/molAngiotensin (1-12) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin (1-12) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N19O17Purity:Min. 95%Molecular weight:1,572.81 g/mol(D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molPAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molGRPP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about GRPP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H215N41O58SPurity:Min. 95%Molecular weight:3,384.47 g/mol(D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H106N22O12Purity:Min. 95%Molecular weight:1,375.67 g/molDSP
CAS:<p>DSP is a widely used disulfide crosslinker in ADC synthesis. It forms reversible conjugates via intracellular reduction, enabling payload release.</p>Formula:C14H16N2O8S2Purity:Min. 95%Color and Shape:SolidMolecular weight:404.42 g/molH-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt
CAS:<p>H-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt (KCTA) is a peptide that belongs to the group of thioneins and is characterized by a high content of lysine, cysteine and histidine residues. This peptide has been shown to be effective in treating subcutaneous tumors in mice. KCTA binds to metallothionein and gamma amino butyric acid (GABA), which are proteins that regulate energy metabolism in cells. KCTA has also been shown to have antimicrobial effects against human serum, which may be due to its ability to bind with thionein.</p>Formula:C22H41N7O8S3Purity:Min. 95%Molecular weight:627.8 g/mol3-p-Coumaroylquinic acid
CAS:<p>3-p-Coumaroylquinic acid is a natural compound found in plants. It has been shown to have antibacterial properties and can be used as an alternative to antibiotics for the treatment of opportunistic fungal infections. 3-p-Coumaroylquinic acid exhibits hypoglycemic activity, which may be due to its ability to inhibit glucose absorption by the gut. This compound can also be analyzed using a surface methodology that involves analyzing the surface of an object with a chemical reagent.</p>Formula:C16H18O8Purity:Min. 95%Color and Shape:PowderMolecular weight:338.31 g/molDehydroacetic acid sodium salt
CAS:<p>Dehydroacetic acid sodium salt is a chemical compound with the formula CH3COOCH2NaO2. It is an ionic liquid that can be used as a preservative or stabilizer in foods and other products. Dehydroacetic acid sodium salt has been shown to inhibit the growth of bacteria and fungi in biological studies. The analytical method for dehydroacetic acid sodium salt is based on x-ray diffraction data, which is used to identify its purity and concentration. The reaction solution includes dehydroacetic acid, water vapor, sodium salts, phosphorus pentoxide, and control analysis.</p>Formula:C8H7O4NaPurity:Min. 95%Color and Shape:PowderMolecular weight:190.13 g/mol5,7-Dimethyl-[1,2,4]triazolo[1,5-a]pyrimidine-2-carboxylic acid
CAS:<p>Please enquire for more information about 5,7-Dimethyl-[1,2,4]triazolo[1,5-a]pyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8N4O2Purity:Min. 95%Molecular weight:192.17 g/molNocistatin (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O32Purity:Min. 95%Molecular weight:1,927.07 g/mol3-Maleimidophenyl boronic acid
CAS:<p>Please enquire for more information about 3-Maleimidophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H8NO4BPurity:Min. 95%Molecular weight:216.99 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/mol[4-(1-Cyano-1-methylethyl)phenyl]boronic acid
CAS:<p>Please enquire for more information about [4-(1-Cyano-1-methylethyl)phenyl]boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12BNO2Purity:Min. 95%Molecular weight:189.02 g/mol(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:<p>(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt H-Ala-Tyr-Pro-Gly-Lys-Phe-OH trifluoroacetate salt is a potent inhibitor of protein kinase C, and has been shown to inhibit the growth of prostate cancer cells. It also inhibits phosphorylation of epidermal growth factor receptors, which leads to lower levels of epidermal growth factor in the cell. This drug also has antiplatelet effects and may be used as an antiplatelet agent for patients with vascular disease or diabetes.</p>Formula:C34H47N7O8Purity:Min. 95%Molecular weight:681.78 g/mol(Asp76)-pTH (39-84) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp76)-pTH (39-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C211H356N66O73Purity:Min. 95%Molecular weight:4,985.49 g/molBAM-22P (8-22) trifluoroacetate salt
CAS:<p>BAM-22P (8-22) trifluoroacetate salt is a compound that has been shown to be an effective drug for the treatment of pain. It has been shown to have an effect on bone cancer, which can be activated by serotonin. This compound may be beneficial in treating nerve injury and fibrosarcoma cells. BAM-22P (8-22) trifluoroacetate salt is an allosteric modulator of the serotonin receptor and may be used as a treatment for pain in wild-type mice. The molecule is also a serotonin reuptake inhibitor, which prevents the reuptake of serotonin into the presynaptic neuron. This leads to increased levels of serotonin in the synapse and increased pain relief.</p>Formula:C91H127N25O23SPurity:Min. 95%Molecular weight:1,971.2 g/molMelanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H72N10O15Purity:Min. 95%Molecular weight:1,005.12 g/molN-Des(2-diethylamino) metoclopramide acetic acid
CAS:<p>N-Des(2-diethylamino) metoclopramide acetic acid is a benzyl ester of metoclopramide, a prodrug that is metabolized to the active form in the body. It has been shown to be effective against healthy human subjects and hplc analyses of biological samples have shown it to be a metabolite of metoclopramide. N-Des(2-diethylamino) metoclopramide acetic acid is used as a catalyst for catalytic hydrogenation reactions, such as the conversion of methyl esters into ethyl or butyl esters. It can also be used for catalytic hydrogenation reactions with diazomethane, such as those required for the synthesis of quinolones.</p>Formula:C10H11ClN2O4Purity:Min. 95%Molecular weight:258.66 g/mol(Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H277N51O49S2Purity:Min. 95%Molecular weight:3,847.43 g/molMca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H80N16O16Purity:Min. 95%Molecular weight:1,221.32 g/mol(H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt
CAS:<p>Please enquire for more information about (H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H66N10O23Purity:Min. 95%Molecular weight:1,247.18 g/mol2-Amino-5-(trifluoromethoxy)benzoic acid
CAS:<p>Please enquire for more information about 2-Amino-5-(trifluoromethoxy)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H6F3NO3Purity:Min. 95%Molecular weight:221.13 g/molAngiotensin A trifluoroacetate salt
CAS:<p>Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH is a drug that has been shown to be effective in treating chronic kidney disease and heart failure. It is a synthetic peptide that mimics the activity of angiotensin II, an important regulator of blood pressure. Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH binds to the angiotensin receptor, which causes vasoconstriction and increases the release of soluble guanylate cyclase. This drug also inhibits the production of matrix metalloproteinases, which break down collagen and other extracellular proteins.</p>Formula:C49H71N13O10Purity:Min. 95%Molecular weight:1,002.17 g/molMca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H65N13O15Purity:Min. 95%Molecular weight:1,100.14 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS:<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.</p>Formula:C7H10N2O4•HBrPurity:Min. 95%Molecular weight:267.08 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H83N17O13Purity:Min. 95%Color and Shape:PowderMolecular weight:1,274.43 g/moltrans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate
CAS:<p>Trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate (CDTA) is a chelating agent that has been shown to be effective in the treatment of some cancers. CDTA has been shown to inhibit the growth of tumor cells by binding to lysine residues on histones and DNA and inhibiting their acetylation. CDTA also prevents the genotoxicity induced by irradiation. CDTA can be used as an adjuvant in cancer therapy due to its ability to inhibit histone deacetylase activity. Trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate is synthesized from two amino acids: lysine and glutamic acid. This molecule is a polymeric compound composed of cyclic molecules linked together through amide bonds. These polymers are linear chains of</p>Formula:C14H22N2O8·H2OColor and Shape:White PowderMolecular weight:364.35 g/molTyr-α-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-alpha-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C172H276N52O51S2Purity:Min. 95%Molecular weight:3,952.48 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13·C2HF3O2Purity:Min. 95%Molecular weight:1,310.34 g/molH-Lys-Gly-Asp-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Asp-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H27N5O8Purity:Min. 95%Molecular weight:405.4 g/molN-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt
CAS:<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>Formula:C32H36N4O7Purity:Min. 95%Molecular weight:588.65 g/molAnthranilyl-HIV Protease Substrate III trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H100N20O17Purity:Min. 95%Molecular weight:1,433.61 g/molPentafluoropropionic acid
CAS:<p>Pentafluoropropionic acid is a glycol ether that is used in the preparation of coumarin derivatives. It reacts with sodium carbonate and trifluoroacetic acid to form the corresponding acyl chloride, which then reacts with nitrogen atoms (e.g., ammonia) to form an amide or urea derivative. Pentafluoropropionic acid also reacts with hydrogen fluoride to form pentafluoropropane and hydrogen fluoride gas, which can be used as a propellant for aerosol sprays. Pentafluoropropionic acid binds to toll-like receptors on cancer cells and human serum, inhibiting their ability to synthesize DNA. The compound has been shown to inhibit tumor growth in mice by blocking the formation of cancer tissues.</p>Formula:C3HF5O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:164.03 g/molmeso-Tartaric acid monohydrate
CAS:<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>Formula:C4H6O6·H2OPurity:Min. 95%Color and Shape:White PowderMolecular weight:168.1 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molH-Phe-Arg-Arg-OH acetate salt
CAS:<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>Formula:C21H35N9O4Purity:Min. 95%Molecular weight:477.56 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H175N31O35S2Purity:Min. 95%Molecular weight:2,627.95 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molH-Gly-Gly-Lys-Arg-OH acetate salt
CAS:<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>Formula:C16H32N8O5Purity:Min. 95%Molecular weight:416.48 g/mol(2-Chlorophenyl)boronic acid
CAS:<p>2-Chlorophenylboronic acid is a diphenyl ether that can be used as a building block for the synthesis of benzodiazepine receptor ligands. It has been shown to be an efficient nucleophile, leading to the formation of carbonyl groups in the presence of halides. 2-Chlorophenylboronic acid has also been shown to inhibit p38 kinase activity and may be useful for anticancer therapy.</p>Formula:C6H6BClO2Purity:Min. 95%Molecular weight:156.37 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/mol(Ala13)-Apelin-13 (human, bovine, mouse, rat) acetate salt
CAS:<p>Apelin-13 is a peptide hormone that is secreted from the stomach and small intestine. It may have analgesic effects through its interaction with μ-opioid receptors, which are also activated by morphine. Apelin-13 has been shown to increase locomotor activity in rats, suggesting it can potentiate the antinociceptive effect of morphine.</p>Formula:C63H107N23O16S·xC2H4O2Purity:Min. 95%Molecular weight:1,474.74 g/molAbz-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H58N12O16Purity:Min. 95%Molecular weight:986.98 g/molNeuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H310N58O61S2Purity:Min. 95%Molecular weight:4,627.14 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS:<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/molLHRH (4-10) acetate salt
CAS:<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H53N11O9Purity:Min. 95%Molecular weight:747.84 g/molH-Met-Arg-OH acetate salt
CAS:<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/molPep-1-cysteamide trifluoroacetate salt
CAS:<p>Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H202N36O33SPurity:Min. 95%Molecular weight:2,949.39 g/molOsteoblast Activating Peptide (human) trifluoroacetate salt
<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37SPurity:Min. 95%Molecular weight:2,795.14 g/molMethyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate
CAS:<p>Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BrNO3Purity:Min. 95%Molecular weight:246.06 g/molVIP (3-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H226N40O39SPurity:Min. 95%Molecular weight:3,101.58 g/molChloromethyl acetate
CAS:<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>Formula:C3H5ClO2Purity:Min. 95%Molecular weight:108.52 g/molDiisopropyl azodicarboxylate - 40% toluene solution
CAS:<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>Formula:C8H14N2O4Purity:Min. 95%Color and Shape:Yellow To Yellow Orange LiquidMolecular weight:202.21 g/mol3-(3,5-Dimethoxyphenyl)propionic acid methyl ester
CAS:<p>3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is a reagent that is used as a reactant in organic synthesis. It is also useful as a scaffold for the synthesis of heterocycles and other complex compounds. 3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is used in research chemical synthesis and as a versatile building block for the production of fine chemicals. This chemical can be used to create products such as pharmaceuticals, pesticides, and cosmetics.</p>Formula:C12H16O4Purity:Min. 95%Molecular weight:224.25 g/mol(Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H203N37O30SPurity:Min. 95%Molecular weight:2,796.3 g/molH-Ala-His-Lys-OH acetate salt
CAS:<p>H-Ala-His-Lys-OH acetate salt is a copper complex that has been shown to have antioxidant properties in vitro. It has been studied for use as an analog of the vitamin C, which is a cofactor for collagen synthesis and follicular keratinization. Copper complexes with H-Ala-His-Lys-OH acetate salt have been shown to inhibit the formation of reactive oxygen species (ROS) and to stimulate collagen production by human dermal fibroblasts in vitro. This compound also stimulates the growth of human skin cells in vitro, which may be due to its ability to induce fibroblast proliferation.</p>Formula:C15H26N6O4Purity:Min. 95%Molecular weight:354.4 g/mol(Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molH-Pro-Pro-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/mol2-Bromo-3-methylbenzoic acid
CAS:<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>Formula:C8H7BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:215.04 g/molBradykinin (2-7) acetate salt
CAS:<p>Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N6O8Purity:Min. 95%Molecular weight:600.66 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/molNeuropeptide VF (124-131) (human) trifluoroacetate salt
CAS:<p>Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.</p>Formula:C45H72N14O10Purity:Min. 95%Molecular weight:969.14 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS:<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>Formula:C106H172N32O32Purity:Min. 95%Molecular weight:2,406.7 g/mol(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H308N58O53Purity:Min. 95%Molecular weight:4,324.9 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/mol3-Benzoyl acrylic acid
CAS:<p>3-Benzoyl acrylic acid is an organic compound that is the product of a chemical reaction between benzaldehyde and acetic anhydride. It contains a carboxylic acid group, an hydroxyl group, a nitro group, and a particle. 3-Benzoyl acrylic acid has been shown to inhibit the growth factor epidermal growth factor (EGF). This inhibition occurs by binding to the receptor for EGF on the cell membrane and blocking its activation. 3-Benzoyl acrylic acid also inhibits fatty acid synthesis and mitochondrial membrane potential, which may be due to its ability to form ester hydrochloride.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:176.17 g/molD-α-Hydroxyisovaleric acid
CAS:<p>D-alpha-Hydroxyisovaleric acid is a compound that is used to synthesize stereoisomers. It is also a component of supramolecular chemistry and has been used in the construction of supramolecular polymers. D-alpha-Hydroxyisovaleric acid can be found in some plants, such as valinomycin, isovaleric acid, and metarhizium. This stereoisomer can be synthetized from the hydroxy group and an amino acid or peptide. D-alpha-Hydroxyisovaleric acid has the ability to degrade nonribosomal peptides into smaller molecules through its hydrolytic properties. It also inhibits Verticillium dahliae, which causes wilt disease in plants, by inhibiting the synthesis of hydroxycarboxylates. D-alpha-Hydroxyisovaleric acid is biodegradable and can be used for industrial purposes as well as pharmaceuticals.</p>Formula:C5H10O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:118.13 g/molH-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
CAS:<p>L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.</p>Formula:C21H42N6O5Purity:Min. 95%Molecular weight:458.6 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/molNeuronostatin-13 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H112N20O17Purity:Min. 95%Molecular weight:1,445.71 g/molBeclomethasone 21-acetate 17-propionate
CAS:Controlled Product<p>Please enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H35ClO7Purity:Min. 95%Molecular weight:507.02 g/mol1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H24N4O4Purity:Min. 95%Molecular weight:360.41 g/mol4-Hydroxyphenyl acetate
CAS:<p>4-Hydroxyphenyl acetate is a naturally occurring fatty acid that is found in many plants. It has been isolated from the seeds of Telfairia occidentalis and has been shown to inhibit the growth of bacteria at a pH of 7.5, with an optimal pH of 8.0. 4-Hydroxyphenyl acetate is an activated form of this compound, which means it contains two hydroxyl groups and does not have to be synthesized by enzymes. 4-Hydroxyphenyl acetate inhibits bacterial enzyme activities such as DNA gyrase and RNA polymerase, which are necessary for transcription and replication. The structure analysis of 4-hydroxy phenylacetate was determined using trifluoroacetic acid (TFA) on a wild-type strain of Escherichia coli K12.</p>Formula:C8H8O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:152.15 g/molTRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/moltert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate
CAS:<p>Please enquire for more information about tert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/molH-Arg-Phe-OH acetate salt
CAS:<p>H-Arg-Phe-OH Acetate Salt is a peptide that has the amino acids H, Arg, Phe and OH. It is a stable complex with amines and is effective in reducing blood pressure. The binding constants are high, which means that it can be used as an antihypertensive agent. A study on the haemodynamic effects of H-Arg-Phe-OH Acetate Salt showed that it could inhibit the release of noradrenaline levels in the body. The reaction mechanism for H-Arg-Phe-OH Acetate Salt is functional groups plus fatty acids; kidney bean is one of its sources.</p>Formula:C15H23N5O3Purity:Min. 95%Molecular weight:321.38 g/mol(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid
CAS:<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>Formula:C12H15NO5Purity:Min. 95%Molecular weight:253.25 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molAntifreeze Polypeptide 6 (winter flounder) trifluoroacetate salt
CAS:<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>Formula:C133H225N43O51•xC2HF3O2Purity:Min. 95%Molecular weight:3,242.47 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H222N38O49Purity:Min. 95%Molecular weight:3,161.43 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Formula:C50H80N14O14SPurity:Min. 95%Molecular weight:1,133.32 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate
CAS:<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>Formula:C109H159N25O32S5•(C2H4O2)xPurity:Min. 95%Molecular weight:2,491.91 g/molAtrial Natriuretic Factor (5-27) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H154N34O32S3Purity:Min. 95%Molecular weight:2,404.67 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molCART (55-102) (human) trifluoroacetate salt
CAS:<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>Formula:C225H365N65O65S7Purity:Min. 95%Molecular weight:5,245.17 g/molPhenyl pyruvic acid
CAS:<p>Phenyl pyruvic acid is a sodium salt of phenylpyruvic acid that can be synthesized from phenylalanine, an amino acid. It has been shown to have antioxidant and anti-inflammatory properties. Phenyl pyruvic acid was found to inhibit oxidative injury caused by sodium nitroprusside in the rat brain, liver, and heart. Phenyl pyruvic acid also increased the activity of 3t3-l1 preadipocytes and improved energy metabolism in these cells. The synthesis of phenylpyruvate is catalyzed by a decarboxylase enzyme and it can be converted into insulin or phenylalanine.</p>Formula:C9H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:164.16 g/molOrotic acid anhydrous
CAS:<p>Orotic acid anhydrous is a hydrogen bonding interaction that can be found in biological systems. It plays a role in the physiological effects of orotic acid, which is a metabolite of uridine and an intermediate in the synthesis of pyrimidine nucleotides. Orotic acid has antimicrobial properties and has been shown to inhibit enzyme activities involved in energy metabolism, such as polymerase chain reaction (PCR) and adenosine triphosphate (ATP) synthase. Orotic acid also inhibits the growth of bacteria, fungi, and parasites. Orotic acid anhydrous is used for treating myocardial infarcts or brain functions. The untreated group was given no treatment at all.</p>Formula:C5H4N2O4Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:156.1 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>Purity:Min. 95%Molecular weight:171.22 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H77N17O11Purity:Min. 95%Molecular weight:1,200.35 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C121H168N26O33S4Purity:Min. 95%Molecular weight:2,643.05 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molAngiotensin II acetate salt
CAS:Controlled Product<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>Formula:C50H71N13O12·xC2H4O2Purity:Min. 95%Color and Shape:White SolidMolecular weight:1,046.18 g/mol(2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate
CAS:Controlled Product<p>Please enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H17NO2•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:285.26 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Formula:C27H36N10O10Purity:Min. 95%Molecular weight:660.64 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H70N16O12Purity:Min. 95%Molecular weight:1,099.2 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/molMet-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H47N9O8SPurity:Min. 95%Molecular weight:729.85 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H98N18O20SPurity:Min. 95%Molecular weight:1,447.62 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%4-Difluoromethoxyphenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H17BF2O3Purity:Min. 95%Molecular weight:270.08 g/molEglin c (60-63)-methyl ester acetate salt
CAS:<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>Formula:C19H35N5O7Purity:Min. 95%Molecular weight:445.51 g/mol2,4,5-Trifluorobenzoic acid
CAS:<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>Formula:C7H3F3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:176.09 g/mol(Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H284N54O56SPurity:Min. 95%Molecular weight:4,240.67 g/mol1-Naphthylphosphoric acid calcium
CAS:<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>Formula:C20H18O8P2•CaPurity:Min. 95%Color and Shape:PowderMolecular weight:488.38 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/mol4-Pyridinylboronic acid
CAS:<p>4-Pyridinylboronic acid is a boron compound that contains two nitrogen atoms. It is an important reagent in organic synthesis and crystallography. 4-Pyridinylboronic acid has been shown to have biological properties, such as hydrogen bonding interactions. It is also used in the suzuki coupling reaction and the photochemical properties of the reaction solution are dependent on its coordination geometry. 4-pyridinylboronic acid has a high pH value, so it must be prepared in anhydrous sodium carbonate before use. The hydrogen bond between 4-pyridinylboronic acid and an azide is shown below: Nnowiki>/nowiki>Hnowiki>/nowiki>nowiki>/nowiki>Nnowiki>/nowiki>nowiki>/nowiki>H</p>Formula:C5H6BNO2Color and Shape:PowderMolecular weight:122.92 g/mol(R)-(-)-3-Amino-3-phenylpropionic acid
CAS:<p>(R)-(-)-3-Amino-3-phenylpropionic acid is a hydrogenated, stereoselective β-amino acid that is involved in the biosynthesis of animal health. The enzyme acylase catalyzes this reaction by binding with chiral pyridoxal phosphate to form an acylation product. The stereospecificity of the reaction is determined by whether the enzyme has a preference for L or D amino acids. Acylases are found in organisms such as mammals and bacteria.</p>Formula:C9H11NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:165.19 g/mol12-(Boc-aminooxy)-dodecanoic acid
CAS:<p>Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H33NO5Purity:Min. 95%Molecular weight:331.45 g/molBoc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid
CAS:<p>Please enquire for more information about Boc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25NO5Purity:Min. 95%Molecular weight:275.34 g/molNeuromedin U-25 (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H217N43O37Purity:Min. 95%Molecular weight:3,142.53 g/mol2-Phenyl-5-benzimidazolesulfonic acid
CAS:<p>2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,</p>Formula:C13H10N2O3SPurity:Min. 95%Molecular weight:274.3 g/molApelin-36 (1-16) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Apelin-36 (1-16) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H117N27O20Purity:Min. 95%Molecular weight:1,704.89 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS:<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Formula:C84H119N27O28Purity:Min. 95%Molecular weight:1,955.01 g/mol3-Chlorophenyl acetic acid
CAS:<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>Formula:C8H7ClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:170.59 g/molBromofluoroacetic Acid
CAS:<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>Formula:C2H2BrFO2Purity:Min. 95%Molecular weight:156.94 g/molH-Gly-His-Arg-Pro-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N10O4Purity:Min. 95%Molecular weight:464.52 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H82N16O11S3Purity:Min. 95%Molecular weight:1,167.47 g/mol4-tert-Butylphenylboronic acid
CAS:<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>Formula:C10H15BO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:178.04 g/mol(Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H69N9O8Purity:Min. 95%Molecular weight:852.07 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H70N12O20Purity:Min. 95%Molecular weight:1,195.19 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/molMet-RANTES (human) trifluoroacetate salt
<p>Please enquire for more information about Met-RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C355H543N97O101S6Purity:Min. 95%Molecular weight:7,978.1 g/molBenzyl acetate
CAS:<p>Benzyl acetate is a colorless liquid that has a pleasant odor. It is used as a flavoring agent in food, beverages and tobacco products. Benzyl acetate is also used as an intermediate in the production of other chemicals. A low-dose group of rats was given benzyl acetate at doses of 0.5, 1, 5 and 10 mg/kg/day for 30 days. The animals were observed for changes in enzyme activities and thermal expansion reactions. Chronic exposure to benzyl acetate may cause carcinogenesis by inducing dimethyl fumarate (DMF) or methyl transferase activity.</p>Formula:C9H10O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:150.17 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molH-Tyr-Tyr-Phe-OH acetate salt
CAS:<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>Formula:C27H29N3O6Purity:Min. 95%Molecular weight:491.54 g/molH-Gly-Pro-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.</p>Formula:C12H19N3O4Purity:Min. 95%Molecular weight:269.3 g/molPAR-3 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O8Purity:Min. 95%Molecular weight:576.6 g/mol3-Amino-4-fluorobenzoic acid
CAS:<p>3-Amino-4-fluorobenzoic acid is a hydrocarbon that is used as an analgesic. It has been shown to be nontoxic and has analgesic effects in the intestinal tract. 3-Amino-4-fluorobenzoic acid also has radiopaque properties, which makes it useful for diagnosis and treatment of certain types of cancer and other tumors. The analgesic effect of 3-amino-4-fluorobenzoic acid may be due to its ability to act as a competitive antagonist at the N -methyl--aspartate (NMDA) receptor, which is important in pain perception.</p>Formula:C7H6FNO2Purity:Min. 95%Molecular weight:155.13 g/molH-D-Phe-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/mol(Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H287N55O57SPurity:Min. 95%Molecular weight:4,285.71 g/mol4-Acetyl-piperidine-1-carboxylic acid tert-butyl ester
CAS:<p>4-Acetylpiperidine-1-carboxylic acid tert-butyl ester is a tert-butyl ester of 4-acetylpiperidine. It can be prepared by the reaction of sodium azide with chloroform and tert-butyl alcohol. The resulting product is a white solid that can be used as an intermediate in organic synthesis.</p>Formula:C12H21NO3Purity:Min. 95%Molecular weight:227.3 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS:<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formula:C70H104N22O18S·C2HF3O2Purity:Min. 95%Color and Shape:Red SolidMolecular weight:1,687.8 g/molOsteostatin amide trifluoroacetate
CAS:<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O57•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,450.59 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS:<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>Formula:C17H18O3Purity:Min. 95%Molecular weight:270.32 g/molLIP2 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H288N58O58Purity:Min. 95%Molecular weight:4,240.61 g/mol2,3,4,5-Tetrafluorobenzoic acid
CAS:<p>Tetrafluorobenzoic acid is a synthetic chemical that is used in the synthesis of antimicrobial agents. Tetrafluorobenzoic acid has been shown to bind to the hydroxyl group of 2,3,4,5-tetrafluorobenzoyl chloride and form a covalent bond. The reaction solution was analyzed using crystallography and showed that there are no intermolecular hydrogen bonds between tetrafluorobenzoic acid molecules. The crystal structure was determined by X-ray diffraction analysis and found that the intramolecular hydrogen bonding may be responsible for the anti-microbial activity of this substance.</p>Formula:C7H2F4O2Molecular weight:194.08 g/molSuc-Ala-Phe-Lys-AMC acetate
CAS:<p>Suc-Ala-Phe-Lys-AMC acetate salt is a fatty acid that is metabolized by the enzyme plasminogen activator inhibitor 1 (PAI-1) to form AMC. It is used as a marker for PAI-1 activity in plasma, as well as in other extracellular fluids. Suc-Ala-Phe-Lys-AMC acetate salt has been shown to be effective in treating diseases caused by low blood sugar levels, such as diabetes mellitus type 2. Studies have also shown that it can be used to monitor the progress of metabolic disorders such as obesity and type 2 diabetes mellitus.</p>Formula:C32H39N5O8•C2H4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:681.73 g/molCyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.</p>Formula:C28H43N9O7Purity:Min. 95%Molecular weight:617.7 g/mol(D-Lys(nicotinoyl)1,b-(3-pyridyl)-Ala3,3,4-dichloro-D-Phe5,Asn6,D-Trp7·9, Nle 11)-Substance P trifluoroacetate salt
CAS:<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>Formula:C86H104Cl2N18O13Purity:Min. 95%Molecular weight:1,668.76 g/molACTH (1-39) (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C210H315N57O57SPurity:Min. 95%Molecular weight:4,582.16 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H278N54O55Purity:Min. 95%Molecular weight:4,090.47 g/molNeuropeptide F trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide F trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H328N58O58Purity:Min. 95%Molecular weight:4,593.21 g/molH-Phe-AMC trifluoroacetate salt
CAS:<p>H-Phe-AMC Trifluoroacetate salt is a synthetic, protease inhibitor that inhibits the activity of serine and cysteine proteases. It binds to the active site of these enzymes and blocks their function. H-Phe-AMC trifluoroacetate salt has been used in food chemistry to hydrolyze proteins, and can be used to measure enzyme activities. This product also has been shown to have biological functions such as the inhibition of molting, physiological function, and the prevention of carcinogenesis.</p>Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.36 g/mol(4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid
CAS:<p>Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H11BO4Purity:Min. 95%Molecular weight:193.99 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H179N35O28SPurity:Min. 95%Molecular weight:2,591.99 g/mol3-Acetylphenylboronic acid, pinacol ester
CAS:<p>Please enquire for more information about 3-Acetylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19BO3Purity:Min. 95%Molecular weight:246.11 g/molAcetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt
CAS:<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>Formula:C22H40N6O8Purity:Min. 95%Molecular weight:516.59 g/molGanoderic acid G
CAS:Controlled Product<p>Ganoderic acid G is a natural compound that has been extracted from the mushroom Ganoderma lucidum. It has been shown to have anticancer, anti-inflammatory, immunomodulatory, and antioxidant properties. Ganoderic acid G inhibits cancer cell proliferation by inhibiting fatty acid synthesis and promoting apoptosis in cancer cells. It also inhibits the production of inflammatory cytokines such as tumor necrosis factor-α (TNF-α). Ganoderic acid G has been found to inhibit the production of reactive oxygen species in human liver cells.</p>Formula:C30H44O8Purity:Min. 95%Color and Shape:SolidMolecular weight:532.67 g/molQuinoline-4-carboxylic acid
CAS:<p>Quinoline-4-carboxylic acid is a natural compound that is derived from the amino acid tryptophan. It has been shown to have antiinflammatory activity and to be an inhibitor of prostaglandin synthesis. Quinoline-4-carboxylic acid inhibits the growth of carcinoma cells in culture by inducing apoptosis, which is mediated by inhibition of protein synthesis. Quinoline-4-carboxylic acid also has pharmacokinetic properties, including a low volume of distribution, low clearance rate and high bioavailability.</p>Formula:C10H7NO2Purity:Min. 97 Area-%Molecular weight:173.17 g/molH-His-His-OH trifluoroacetate salt
CAS:<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>Formula:C12H16N6O3Purity:Min. 95%Molecular weight:292.29 g/molH-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-OH acetate salt is a protease inhibitor. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, in vitro. H-Arg-Arg-OH acetate salt binds to the active site of the enzyme and prevents substrate binding. The acidity of the environment where this inhibitor is active can be used to control its activity. At acidic pH, H-Arg-Arg-OH acetate salt is more potent than at neutral pH. When it comes into contact with a protein substrate, H-Arg-Arg-OH acetate salt will bind to a hydroxyl group on the protein molecule and prevent it from hydrolyzing its substrate. This process can be reversed by adding an alkaline buffer to increase the pH of the system or by adding an acid buffer to decrease it.br>br> H-Arg-Arg-OH acetate salt is found in cyanob</p>Formula:C12H26N8O3Purity:Min. 95%Molecular weight:330.39 g/molEthyl 4-amino-2-mercaptopyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Ethyl 4-amino-2-mercaptopyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H9N3O2SPurity:Min. 95%Molecular weight:199.23 g/molH-Arg-Ile-OH acetate salt
CAS:<p>H-Arg-Ile-OH acetate salt is a regulatory protein that is found in plant cells. It has been shown to be involved in the regulation of cancer, as well as having some anti-inflammatory activities. H-Arg-Ile-OH acetate salt also has been shown to inhibit the production of fatty acids and coagulation factors by inhibiting serine proteases and thromboplastin activity, respectively. H-Arg-Ile-OH acetate salt may have an important role in regulating blood clotting by preventing fibrinogen from converting to fibrin, which leads to clot formation.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Formula:C50H73N13O11Purity:Min. 95%Molecular weight:1,032.2 g/molGliadorphin-7 trifluoroacetate salt
CAS:<p>Gliadorphin is a peptide that occurs in cow's milk. It has been shown to be effective against bacterial translocation, which is the passage of bacteria from the gut into other parts of the body. Gliadorphin also has a safety profile, with no observed adverse effects in animal studies and dietary trials. The biological samples used for this study were casein and urine samples. The antibodies used were polyclonal antibodies and Gliadorphin was tested for its ability to bind to bacterial proteins in vivo. Hydration may be necessary for optimal absorption of gliadorphin, as dehydration can affect immune reaction. Gliadorphin does not have any known side effects or drug interactions, but it should not be used by people with an allergy to casein or those who are allergic to mammalian serine proteases (such as trypsin).</p>Formula:C43H57N9O11Purity:Min. 95%Molecular weight:875.97 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H113N21O25Purity:Min. 95%Molecular weight:1,888.99 g/molH-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>Formula:C20H35N9O10SPurity:Min. 95%Molecular weight:593.61 g/molH-Met-Cys-Glu-Lys-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Met-Cys-Glu-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H35N5O7S2Purity:Min. 95%Molecular weight:509.64 g/molFITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H191N37O25S2Purity:Min. 95%Molecular weight:2,748.28 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H63N15O13Purity:Min. 95%Molecular weight:1,082.13 g/molAcetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C157H252N44O43SPurity:Min. 95%Molecular weight:3,476.02 g/moltert-Butyl acetate
CAS:<p>tert-Butyl acetate is an organic compound that is used in the synthesis of pharmaceuticals. It is a colorless liquid that can be evaporated to produce a white solid. It has a strong odor and is soluble in water, acetone, and most other organic solvents. Tert-butyl acetate can also be used as a solvent for coatings and adhesives, or as an additive to fuels.</p>Formula:C6H12O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:116.16 g/molGAP 27 acetate salt
CAS:<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>Formula:C60H101N15O17Purity:Min. 95%Molecular weight:1,304.53 g/mol
