Carboxylic Acids

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Aplysia californica is a species of sea slug that produces a peptide, beta-Bag Cell Peptide (BACP), which has been shown to have depolarizing effects on neurons. BACP can be synthesized from the amino acid sequence of the Aplysia californica cell membrane protein, and this synthetic peptide has been shown to have maximal depolarizing effects at high concentrations. The depolarizing effect of BACP can be seen in populations of neurons as well as individual neurons. This peptide also desensitizes autoreceptors for acetylcholine and serotonin, which may play a role in its electrophysiological effects.</p>

<p>5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid is a chemical compound that is used in the formylation of amines to produce formamides. It has been optimized for industrial production by optimizing reaction time, formylation conditions, and solvents. It has also been shown that 5-formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid produces good yields and high product purity.</p>

<p>Please enquire for more information about N-Fmoc-L-gamma-carboxyglutamic acid gamma,gamma-di-t-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>

<p>Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,1-Cyclohexanediacetic acid anhydride is a synthetic polymer that is soluble in water. It is used in wastewater treatment to remove organic contaminants. 1,1-Cyclohexanediacetic acid anhydride reacts with gabapentin to form amide and monoamide derivatives. This reaction is catalyzed by acylation agents such as hydrochloric acid and organic solvents such as benzene. The resulting products are virulent, allowing them to be used in the treatment of epilepsy.</p>

<p>2-(2-Methoxyethoxy)ethoxy)acetic acid (MEAA) is a cell stabilizer that can be used in the treatment of cancer, diabetes, and other diseases. MEAA has been shown to inhibit the growth of cells by binding to and stabilizing the cytoskeleton through inhibition of protein synthesis. It also prevents the activation of pro-inflammatory cytokines and reactive oxygen species. MEAA's magnetic resonance spectroscopy properties have been studied in detail and it has been shown to bind well with silver ions. MEAA has also been shown to have high cytotoxicity when combined with laser ablation therapy.</p>

<p>Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Hydroxynaphthalene-1-sulfonic acid is a chemical compound with the formula HNSO. It is an organic compound and a proton acceptor. The conjugate base of 7-hydroxynaphthalene-1-sulfonic acid has a strong absorption band in the ultraviolet region. In DMF solution, the reaction of 7-hydroxynaphthalene-1-sulfonic acid with formamide, hydroxy, and nitrogen atoms produces a product that has been characterized by photoexcitation and kinetic studies. The proton transfer process from formamide to 7-hydroxynaphthalene-1-sulfonic acid was found to be exponential and followed first order kinetics. The protonation constant for this process was determined to be 8.4 x 10 M/equivalent. 7HNSO can also act as an electron acceptor in dimethylsulphoxide (DMSO) solution</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>Please enquire for more information about (Des-Pyr 1,D-Ser(tBu)6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>

<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Piperidin-1-ylpropanoic acid is a hydroxylated compound that belongs to the group of aromatic hydrocarbons. It has been shown to inhibit the activity of enzymes such as model studies and test compounds, which are used in biological samples. 3-Piperidin-1-ylpropanoic acid is not active against mouse tumor cells and does not show any locomotor activity. The terminal half life of this drug has been determined in urine samples from mice at 20 hours.</p>

<p>Please enquire for more information about Z-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Aminopyridine-3-carboxylic acid (5APC) is a structural analog of nicotinic acid that has been shown to have anti-inflammatory effects. 5APC inhibits the production of inflammatory cytokines, such as IL-10 and IL-17, by inhibiting the activation of NFκB and MAPK pathways. This drug also has significant inhibitory activities against dextran sulfate sodium (DSS)-induced acute colitis in experimental models. 5APC is thought to act by interrupting the assembly of p38 mitogen activated protein kinase (MAPK) and nuclear factor kappa B (NFκB) signaling complexes.</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Homoterephalic acid is a polycarboxylic acid. It has been shown to be effective in the treatment of tumors, and in clinical studies, it has been shown to have anti-cancer activity. Homoterephalic acid inhibits the growth of tumor cells by inhibiting the synthesis of l-glutamic acid. This compound also exhibits anti-inflammatory properties by inhibiting tumor necrosis factor alpha (TNFα) production. Homoterephalic acid is also an inhibitor of human lung diastereomer 1210 cells, as well as erythrocytes infected with L1210 leukemia cells. Homoterephalic acid is a substrate for glycinamide ribonucleotide synthetase and can be used for the biosynthesis of thymidylate. It can be used for the synthesis of polycarboxylic acids that are important for cell metabolism and protein synthesis.</p>

<p>Endothelin-1 (11-21) trifluoroacetate salt H-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp is a peptide that is derived from endothelin. It has been shown to have an inhibitory effect on insulin stimulated glucose uptake in Sprague Dawley rats. This peptide has also been shown to bind to the endothelin receptor and act as a nonselective agonist. Endothelin 1 (11–21) trifluoroacetate salt H-Cys Val Tyr Phe Cys His Leu Asp Ile Ile Trp, when incubated with cells, had a maximal response at micron concentrations.</p>

<p>Please enquire for more information about 4-[5-(4-Pentyloxyphenyl)isoxazol-3-yl]benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GRPP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>

<p>Please enquire for more information about PAR-2 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>

<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (His(3-Me)2)-TRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-4,5-dimethoxybenzoic acid is a synthetic compound that belongs to the group of anticancer drugs. It is a potent inhibitor of mitochondrial membrane depolarization and has been shown to inhibit tumor growth in vivo. 2-Bromo-4,5-dimethoxybenzoic acid also induces cell death by demethylation and hydroxylation of DNA, leading to apoptosis. This compound is synthesized by reacting 3,4-dihydroxybenzoic acid with bromine and potassium hydroxide. Surrogates such as amides are used for this synthesis because the original product is not stable enough. Protocatechuic acid can be produced from 2-bromo-4,5-dimethoxybenzoic acid through hydrolysis.</p>

<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>

<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Helical CRF (9-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>

<p>Please enquire for more information about Serpinin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>

<p>Tetrabutylammonium acetate is a complex of tetrabutylammonium with the trifluoroacetate anion. It has been used as a reagent for the preparation of α-hydroxylated ketones, including natural products. Tetrabutylammonium acetate can be used in titration calorimetry to measure the heat evolved during the reaction between hydroxyl group and sodium salts. The heat released corresponds to the amount of water produced from this reaction. In this way, it can be determined whether or not a molecule contains an active hydrogen atom. Tetrabutylammonium acetate also reacts with reactive compounds such as dpp-iv inhibitors, forming a reactive intermediate that cannot be isolated due to its instability. This intermediate is detected by analytical methods such as plasma mass spectrometry or infrared spectroscopy. Tetrabutylammonium acetate also reacts with asymmetric synthesis, forming an intram</p>

<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Copeptin (rat) trifluoroacetate salt is a peptide that belongs to the group of protein inhibitors. It can inhibit the activity of the acetylcholine receptor, which leads to an increase in muscle tone and rigidity. Copeptin is also used as a research tool for studying protein interactions, antibody-antigen reactions, cell biology, ligand-receptor binding, pharmacology and life sciences. Copeptin has been shown to inhibit ion channels such as nicotinic receptors and potassium channels. The CAS number for copeptin (rat) trifluoroacetate salt is 86280-64-0.</p>

<p>Please enquire for more information about tert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>

<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt is a synthetic peptide that was designed to simulate the activity of bradykinin. It has been shown to be effective in the treatment of angina pectoris and as an analgesic. This peptide can also be used in the analysis of carboxypeptidase activity, by adding it to homogenates and measuring the reaction products. Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt can also be used to analyze salivary glands, activated erythrocytes, and silicon wafers. It is particularly useful for examining morphology and nanowires.</p>

<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>

<p>Please enquire for more information about HIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>

<p>Intermediate in the synthesis of edoxaban</p>

<p>Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-epsilon-aminocaproyl-Arg-e psilon-aminocaproyl-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TRAF6 Control Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Please enquire for more information about Dermcidin-1L (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The monoclonal antibody (mAb) is a recombinant protein that binds to the extracellular region of the vasopressin receptor. It is used in pharmacological research to study the physiological function and pharmacological effects of vasopressin. The mAb has been shown to be minimally toxic, with an LD50 value of greater than 10 mg/kg in mice. It has also been shown to inhibit viruses and inhibit drug-sensitive enzymes. This antibody can be used as a diagnostic tool for congestive heart disease, as well as in experimental models for studying the minimal toxicity and tumor treatment properties of various drugs.</p>

<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>Please enquire for more information about Ethyl 2-(2-chloroethoxy)acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DL-4-Hydroxymandelic acid is a phenolic acid that belongs to the family of organic acids. It is synthesized from 4-hydroxyphenylpyruvate and p-hydroxybenzoic acid by an enzyme called hydroxylase in the liver. The frequency shift in DL-4-Hydroxymandelic acid is caused by the hydrogen bonding between its hydroxyl group and pyran ring. This reaction occurs spontaneously, with no need for a catalyst or a change in pH. The reaction mechanism starts with the addition of water to the molecule, which results in an intermediate that breaks down into two molecules of formaldehyde and one molecule of formate. The reaction solution was found to be acidic because it contained H+ ions (H+).</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>

<p>Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6,8-Dichlorochromone-2-carboxylic acid is a fine chemical that is used as a building block in the synthesis of complex compounds. It is also a versatile building block that can be used in many reactions, such as nucleophilic substitution, electrophilic addition, and condensation reactions. This compound has CAS number 16722-38-6 and is a reagent for research purposes.</p>

<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-[4-(Diethylamino)-2-hydroxybenzoyl]benzoic acid hexyl ester is a sunscreen agent that has been shown to be effective against the formation of skin cancer. This compound is a white powder that can be used as a cream or lotion and is typically applied to the skin before going out in the sun. 2-[4-(Diethylamino)-2-hydroxybenzoyl]benzoic acid hexyl ester absorbs ultraviolet radiation, preventing it from penetrating the skin and causing damage. The compound also acts as an antioxidant, protecting cells from oxidative stress.</p>

<p>Dehydroacetic acid sodium salt is a chemical compound with the formula CH3COOCH2NaO2. It is an ionic liquid that can be used as a preservative or stabilizer in foods and other products. Dehydroacetic acid sodium salt has been shown to inhibit the growth of bacteria and fungi in biological studies. The analytical method for dehydroacetic acid sodium salt is based on x-ray diffraction data, which is used to identify its purity and concentration. The reaction solution includes dehydroacetic acid, water vapor, sodium salts, phosphorus pentoxide, and control analysis.</p>

<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>