
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Androstanolone acetate
CAS:Controlled Product<p>Androstanolone acetate is a synthetic androgen that has been shown to stimulate the production of testosterone in the testes. Androstanolone acetate has been shown to be effective in treating symptoms of male hypogonadism, as well as erectile dysfunction. The drug also has an antigenic effect, which stimulates the production of antibodies against it. Androstanolone acetate binds to cell specific antigens and stimulates cell proliferation. It has been used in cancer prevention studies, where it was found that it could suppress estrogen-induced endometrial cancer in animals. In addition, Androstanolone acetate is capable of stimulating light emission when incubated with cells and can be detected using chromatographic methods.</p>Formula:C21H32O3Purity:Min. 95%Color and Shape:PowderMolecular weight:332.48 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H216N42O45Purity:Min. 95%Molecular weight:3,183.45 g/mol5-Phenylisoxazole-3-carboxylic acid
CAS:<p>5-Phenylisoxazole-3-carboxylic acid is a phenoxy compound that has been shown to inhibit the growth of tuberculosis bacteria. This drug binds to the postsynaptic potential in the cell membrane and inhibits the effector proteins from interacting with the receptor, preventing neurotransmitter release. The molecular modeling study showed that 5-Phenylisoxazole-3-carboxylic acid interacts with ethyl esters and rifampin, which inhibits xanthine oxidase. Xanthine oxidase inhibitors are used as a treatment for gout and hyperuricemia. 5-Phenylisoxazole-3-carboxylic acid also has fluorimetric properties, which can be used to measure its concentration in biological samples such as urine or plasma. Nitro groups in this drug make it susceptible to oxidation by nitric oxide, which can be monitored using nmr spectra.</p>Formula:C10H7NO3Purity:Min. 95%Molecular weight:189.17 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H279N55O46SPurity:Min. 95%Molecular weight:4,017.58 g/mol1-Naphthylphosphoric acid calcium
CAS:<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>Formula:C20H18O8P2•CaPurity:Min. 95%Color and Shape:PowderMolecular weight:488.38 g/molMethyl 3-chlorophenylacetate
CAS:<p>Methyl 3-chlorophenylacetate is a chemical intermediate that has been used in the synthesis of pharmaceuticals and organic compounds. It has also been used as a reagent for research, especially in the study of organic chemistry. Methyl 3-chlorophenylacetate is a versatile building block and can be used as a reaction component to synthesize other chemicals. This compound is also an excellent scaffold for medicinal chemistry.</p>Formula:C9H9ClO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:184.62 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O9S2Purity:Min. 95%Molecular weight:1,177.83 g/mol(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H297N55O56SPurity:Min. 95%Molecular weight:4,327.84 g/molpTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H314N58O53S2Purity:Min. 95%Molecular weight:4,371.06 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/molH-Lys-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N6O5Purity:Min. 95%Molecular weight:478.59 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molH-Arg-Ser-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N5O4Purity:Min. 95%Molecular weight:261.28 g/moltrans-4-[(2,5-Dihydro-2,5-dioxo-1H-pyrrol-1-yl)methyl]cyclohexanecarboxylic acid
CAS:<p>4-Maleimidomethylcyclohexanecaroboxylic acid (4MAMC) is a bifunctional molecule that is conjugated to a polymer, which has the ability to bind with cellular antigens and target tissue. It is used in clinical chemistry because it can be detected at low concentrations. 4MAMC has been shown to reduce cirrhosis caused by chronic liver injury. 4MAMC also increases the uptake of coagulation factors and decreases the expression of prothrombin, which leads to an increase in clotting time. The localization of 4MAMC is determined by the type of polymer conjugate it is bound with; for example, when it binds with human serum albumin, it localizes on the surface of cells.</p>Formula:C12H15NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:237.25 g/molGastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C225H342N60O66SPurity:Min. 95%Molecular weight:4,975.55 g/molH-Arg-Pro-pNA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O4Purity:Min. 95%Molecular weight:391.43 g/molBis-ACV trifluoroacetate salt
CAS:<p>Bis-ACV trifluoroacetate salt is a regulatory compound that belongs to the class of bis-acids. It is a cytosolic calcium ionophore that binds to the cytosolic calcium ion channel and regulates its activity. Bis-ACV trifluoroacetate salt also has nucleophilic attack on phosphate groups, which are essential for biosynthesis. The enzyme activity of this compound has been studied in various strains of bacteria such as E. coli and S. cerevisiae, and it was found to be involved in the synthesis of oligosaccharides and polysaccharides. This compound can be solubilized by the addition of sodium bicarbonate or urea, which facilitates its use in synthetic reactions. The synthase gene for this compound has been identified from various strains of bacteria such as E. coli and S. cerevisiae, but not from mammalian cells or plants.</p>Formula:C28H48N6O12S2Purity:Min. 95%Molecular weight:724.85 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/mol4-Pyridinylboronic acid
CAS:<p>4-Pyridinylboronic acid is a boron compound that contains two nitrogen atoms. It is an important reagent in organic synthesis and crystallography. 4-Pyridinylboronic acid has been shown to have biological properties, such as hydrogen bonding interactions. It is also used in the suzuki coupling reaction and the photochemical properties of the reaction solution are dependent on its coordination geometry. 4-pyridinylboronic acid has a high pH value, so it must be prepared in anhydrous sodium carbonate before use. The hydrogen bond between 4-pyridinylboronic acid and an azide is shown below: Nnowiki>/nowiki>Hnowiki>/nowiki>nowiki>/nowiki>Nnowiki>/nowiki>nowiki>/nowiki>H</p>Formula:C5H6BNO2Color and Shape:PowderMolecular weight:122.92 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H116N20O19SPurity:Min. 95%Molecular weight:1,657.93 g/mol(R)-(-)-3-Amino-3-phenylpropionic acid
CAS:<p>(R)-(-)-3-Amino-3-phenylpropionic acid is a hydrogenated, stereoselective β-amino acid that is involved in the biosynthesis of animal health. The enzyme acylase catalyzes this reaction by binding with chiral pyridoxal phosphate to form an acylation product. The stereospecificity of the reaction is determined by whether the enzyme has a preference for L or D amino acids. Acylases are found in organisms such as mammals and bacteria.</p>Formula:C9H11NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:165.19 g/molCyclopenten-1-ylboronic acid
CAS:<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>Formula:C5H9BO2Purity:Min. 95%Molecular weight:111.93 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/mol([ring-D5]Phe3)-Octreotide acetate salt
CAS:Controlled Product<p>Please enquire for more information about ([ring-D5]Phe3)-Octreotide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H61D5N10O10S2Purity:Min. 95%Molecular weight:1,024.27 g/molC-Type Natriuretic Peptide (1-53) (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C251H417N81O71S3Purity:Min. 95%Molecular weight:5,801.7 g/mol12-(Boc-aminooxy)-dodecanoic acid
CAS:<p>Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H33NO5Purity:Min. 95%Molecular weight:331.45 g/mol(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H73N11O9S2Purity:Min. 95%Molecular weight:1,192.45 g/molBoc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid
CAS:<p>Please enquire for more information about Boc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25NO5Purity:Min. 95%Molecular weight:275.34 g/molVitamin A acetate - min 2800000 IU/g
CAS:<p>Vitamin A acetate is a retinoid that can be used to supplement dietary intake of vitamin A. It is a synthetic retinoid and is chemically similar to retinol, the natural form of vitamin A. Vitamin A acetate has been shown to have antioxidant properties in vitro and in vivo, which are likely due to its ability to regenerate endogenous antioxidants. This agent also has pro-apoptotic effects on cells that are exposed to oxidative injury or exhibit redox potentials below -400 mV. In addition, it significantly reduces oxidative injury caused by pharmacological agents such as doxorubicin or bleomycin.</p>Formula:C22H32O2Purity:Min 2800000 Iu/GColor and Shape:PowderMolecular weight:328.49 g/molAQEE-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C157H252N48O56Purity:Min. 95%Molecular weight:3,707.97 g/mol2-Mercaptobenzoic acid
CAS:<p>2-Mercaptobenzoic acid is a low potency, but pharmacologically active, compound that has been shown to have antioxidative properties in the mouse tumor model. It has also been shown to cause cancer cell death by reducing the stability of disulfide bonds on proteins and inhibiting the growth of carcinoma cells. 2-Mercaptobenzoic acid is used to treat metabolic disorders, such as diabetes mellitus and hyperlipidemia, and may also be used to treat cancer. 2-Mercaptobenzoic acid is found in human urine at levels of 1.5-3.3μg/mL.<br>2-Mercaptobenzoic acid was first synthesized in 1891 by the German chemist Heinrich Caro (1850-1924).</p>Formula:C7H6O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:154.19 g/molH-Ala-Gly-Tyr-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Ala-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C150H246N44O38Purity:Min. 95%Molecular weight:3,273.83 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS:Controlled Product<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H25N3O6·C2H4O2Purity:Min. 95%Molecular weight:391.42 g/molNeuromedin U-25 (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H217N43O37Purity:Min. 95%Molecular weight:3,142.53 g/molH-Glu-Gly-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N8O7Purity:Min. 95%Molecular weight:480.48 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/mol2-Phenyl-5-benzimidazolesulfonic acid
CAS:<p>2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,</p>Formula:C13H10N2O3SPurity:Min. 95%Molecular weight:274.3 g/molApelin-36 (1-16) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Apelin-36 (1-16) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H117N27O20Purity:Min. 95%Molecular weight:1,704.89 g/molIloprost
CAS:<p>Iloprost is a cyclase inhibitor that is used to treat pulmonary hypertension. It relaxes the smooth muscle cells in the lungs, which causes an increase in blood flow and oxygen levels to the heart and other organs. Iloprost also decreases the production of PGE2 and lowers blood pressure. Iloprost has been shown to be effective in treating chronic viral hepatitis and pulmonary diseases such as primary pulmonary hypertension. This drug can cause hypotension, so it should not be taken by patients with low blood pressure or those who are taking other drugs that can cause hypotension.</p>Formula:C22H32O4Purity:Min. 95%Color and Shape:Solidified MassMolecular weight:360.49 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H203N37O32Purity:Min. 95%Molecular weight:2,700.15 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>Formula:C75H110N24O16S2Purity:Min. 95%Molecular weight:1,667.96 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS:<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Formula:C84H119N27O28Purity:Min. 95%Molecular weight:1,955.01 g/mol(3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19F2NO4Purity:Min. 95%Molecular weight:315.31 g/mol3-Chlorophenyl acetic acid
CAS:<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>Formula:C8H7ClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:170.59 g/molAlarin (human) trifluoroacetate salt
CAS:<p>Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.</p>Formula:C127H205N43O35Purity:Min. 95%Molecular weight:2,894.26 g/molBNP-45 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-45 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C209H354N70O63S2Purity:Min. 95%Molecular weight:4,919.61 g/mol(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester
CAS:<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>Formula:C12H16O3Purity:Min. 95%Color and Shape:LiquidMolecular weight:208.25 g/molHIV (gp120) Antigenic Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H211N41O31SPurity:Min. 95%Molecular weight:2,720.25 g/molBromofluoroacetic Acid
CAS:<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>Formula:C2H2BrFO2Purity:Min. 95%Molecular weight:156.94 g/molH-Gly-His-Arg-Pro-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N10O4Purity:Min. 95%Molecular weight:464.52 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/molDimercaptosuccinic acid
CAS:<p>Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.</p>Formula:C4H6O4S2Color and Shape:White PowderMolecular weight:182.22 g/molEthyl 4-bromoacetoacetate
CAS:<p>Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.</p>Formula:C6H9BrO3Purity:90%NmrMolecular weight:209.04 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H82N16O11S3Purity:Min. 95%Molecular weight:1,167.47 g/mol4-tert-Butylphenylboronic acid
CAS:<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>Formula:C10H15BO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:178.04 g/mol(Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H69N9O8Purity:Min. 95%Molecular weight:852.07 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H70N12O20Purity:Min. 95%Molecular weight:1,195.19 g/molH-Ala-Ala-Ala-OMe acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/molMet-RANTES (human) trifluoroacetate salt
<p>Please enquire for more information about Met-RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C355H543N97O101S6Purity:Min. 95%Molecular weight:7,978.1 g/mol(D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H72N14O12Purity:Min. 95%Molecular weight:1,085.22 g/molPreptin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H268N48O51Purity:Min. 95%Molecular weight:3,932.36 g/molH-Gly-Pro-Arg-Pro-NH2 acetate salt
CAS:<p>H-Gly-Pro-Arg-Pro-NH2 acetate salt is a peptide with antiplatelet activity. It has been shown to inhibit the interaction between fibrinogen and platelets, which leads to the inhibition of thrombin formation and subsequent clotting. The amide bond in this peptide is susceptible to hydrolysis by enzymes such as phospholipase A2, which means that it can be broken down into smaller fragments that have different biological activities. H-Gly-Pro-Arg-Pro-NH2 acetate salt has been shown to inhibit the growth of babesia microti, a causative agent of babesiosis in cattle, through lysis of infected erythrocytes. This drug also inhibits the growth of hemagglutinating virus type 3 (HV3) and filovirus, two viruses that are not yet fully understood.</p>Formula:C18H32N8O4Purity:Min. 95%Molecular weight:424.5 g/molBenzyl acetate
CAS:<p>Benzyl acetate is a colorless liquid that has a pleasant odor. It is used as a flavoring agent in food, beverages and tobacco products. Benzyl acetate is also used as an intermediate in the production of other chemicals. A low-dose group of rats was given benzyl acetate at doses of 0.5, 1, 5 and 10 mg/kg/day for 30 days. The animals were observed for changes in enzyme activities and thermal expansion reactions. Chronic exposure to benzyl acetate may cause carcinogenesis by inducing dimethyl fumarate (DMF) or methyl transferase activity.</p>Formula:C9H10O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:150.17 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molH-Tyr-Tyr-Phe-OH acetate salt
CAS:<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>Formula:C27H29N3O6Purity:Min. 95%Molecular weight:491.54 g/molH-Arg-Leu-OH acetate salt
CAS:<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/mol(D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt
CAS:<p>Please enquire for more information about (D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/mol(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>Formula:C59H84N16O12·xC2H4O2Purity:Min. 95%Molecular weight:1,209.4 g/mol(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H83N17O13Purity:Min. 95%Molecular weight:1,226.39 g/molEthyl 2,4-dichloropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Ethyl 2,4-dichloropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H6Cl2N2O2Purity:Min. 95%Molecular weight:221.04 g/molNeuropeptide Y (22-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H139N29O21Purity:Min. 95%Molecular weight:1,903.2 g/molD,L-Benzylsuccinic acid
CAS:<p>D,L-Benzylsuccinic acid is an oral hypoglycemic agent that belongs to the group of antidiabetic agents. It is a crystalline cellulose-based drug with a hypoglycemic effect. D,L-Benzylsuccinic acid has been shown to be effective in the treatment of autoimmune diseases, such as diabetes mellitus and rheumatoid arthritis. The mechanism of action of this drug is not yet fully understood.</p>Formula:C11H12O4Purity:Min. 95%Molecular weight:208.21 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS:<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H75N9O11·C2HF3O2Purity:Min. 95%Molecular weight:1,080.2 g/molZ-Arg-Arg-Arg-4MbetaNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H53N13O6Purity:Min. 95%Molecular weight:775.9 g/moltert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15BrN2O2SPurity:Min. 95%Molecular weight:319.22 g/mol2-Pyridineboronic acid
CAS:<p>2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.</p>Formula:C5H6BNO2Purity:Min. 95%Molecular weight:122.92 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/molDefensin HNP-3 (human) trifluoroacetate salt
CAS:<p>HNP-3</p>Formula:C151H222N44O40S6Purity:Min. 95%Molecular weight:3,486.05 g/molEthyl diphenylacetate
CAS:<p>Ethyl diphenylacetate is a trifluoromethyl group that has the potential for use as a fungicide. The hydrochloride salt of this compound exhibits high activity against various fungi, such as Rhizoctonia solani, Sclerotium rolfsii, and Botrytis cinerea. Ethyl diphenylacetate has also been shown to be an effective herbicide in plants, as it inhibits the enzyme acetolactate synthase and prevents the formation of branched-chain amino acids. It can also inhibit germination of seeds.</p>Formula:C16H16O2Purity:Min. 95%Molecular weight:240.3 g/mol4-Nitrobenzaldiacetate
CAS:<p>4-Nitrobenzaldiacetate is a crystalline solid that can be obtained by two-dimensional experimental methods. It has been shown to have high reactivity in the presence of ozone and sulfuric acid. The reaction product is the corresponding sulfate salt. The filtration technique is used to separate the desired product from the reaction mixture. This product can also be crystallized with catalytic amounts of sulfuric acid and 4-nitrobenzoic acid. The catalytic oxidation of 4-nitrobenzoic acid to form 4-nitrobenzaldaicetic acid, as well as its subsequent conversion to 4-nitrobenzaldiacetate, are both feasible reactions for this compound.</p>Formula:C11H11NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:253.21 g/molNeuropeptide AF (human) trifluoroacetate salt
CAS:<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Formula:C90H132N26O25Purity:Min. 95%Molecular weight:1,978.17 g/mol3,5-Dibromobenzoic acid methyl ester
CAS:<p>3,5-Dibromobenzoic acid methyl ester is an organic compound that has isomers. It is a synthetic substance with the chemical formula CHBrO. This substance can be obtained by reacting benzoic acid with bromine in the presence of aluminium chloride. The nature of this substance is not known due to its multifold structure. 3,5-Dibromobenzoic acid methyl ester has been shown to absorb light and transfer it to another molecule. This molecule can then emit light of a different wavelength or energy level. The dipole moment of the substance interacts with other molecules in close proximity, leading to the transfer of electrons and photons from one molecule to another.</p>Formula:C8H6Br2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:293.94 g/mol(D-Phe6,Leu-NHEt 13,des-Met14)-Bombesin (6-14) trifluoroacetate salt
CAS:<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>Formula:C49H69N13O9Purity:Min. 95%Molecular weight:984.15 g/molBiotinyl-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H305N57O53S3Purity:Min. 95%Molecular weight:4,344.02 g/mol3-Methylbutanoic acid
CAS:<p>3-Methylbutanoic acid is an antimicrobial agent that belongs to the group of isovaleric acids. It is a product of β-oxidation and has been shown to inhibit the growth of bacteria by reacting with their surface. 3-Methylbutanoic acid inhibits bacterial growth by binding to the pyrazole ring in DNA and altering its conformation, preventing DNA replication. This reaction occurs at a rate comparable to that of other fluoroquinolones, such as ciprofloxacin, levofloxacin, and norfloxacin. 3-Methylbutanoic acid has been shown to have antibacterial activity against both Gram-positive and Gram-negative bacteria, particularly those that are resistant to erythromycin or lincomycin.</p>Formula:C5H10O2Purity:Min. 95%Color and Shape:PowderMolecular weight:102.13 g/molMyelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H114N18O21Purity:Min. 95%Molecular weight:1,543.76 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H68N14O14SPurity:Min. 95%Molecular weight:1,025.14 g/molMethyl 4-tert-butylphenylacetate
CAS:<p>Methyl 4-tert-butylphenylacetate is a chemical compound that has been used in various research collaborations. It is also used as a solvent for the production of octanoic acid and isobutyric acid, which are important chemical compounds for use in the food industry. The utilisation of methyl 4-tert-butylphenylacetate has been studied by researchers in relation to its maltol, levulinate and hexanoic acid derivatives. This compound can be used as a replacement for other chemicals such as sulfate, butanedione and propylene glycol in industrial applications.</p>Formula:C13H18O2Purity:Min. 95%Molecular weight:206.28 g/mol(Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H293N53O58SPurity:Min. 95%Molecular weight:4,315.78 g/molDynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/molThrombin Receptor Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Thrombin Receptor Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H91N17O20S2Purity:Min. 95%Molecular weight:1,410.58 g/molEledoisin acetate salt
CAS:<p>Eledoisin acetate salt is a cell-lysing agent that belongs to the group of potent antagonists. It is an inhibitor of neurokinin-1 receptor which regulates the release of substance P and other inflammatory mediators from nerve terminals. Eledoisin acetate salt has shown to inhibit locomotor activity in rats, as well as nucleotide levels in cells. This drug also has been shown to have carcinoid syndrome-like effects, such as weight loss and diarrhea. These symptoms are caused by the inhibition of substance P at its receptors. The tumor necrosis factor (TNF) may be responsible for these effects, since it causes increased production of substance P in cells.</p>Formula:C54H85N13O15S·xC2H4O2Purity:Min. 95%Molecular weight:1,188.4 g/molZ-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O5·C2H4O2Purity:Min. 95%Molecular weight:679.77 g/molH-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/molKyotorphin acetate salt
CAS:<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/mol3,5-Dichloropyrazine-2-carboxylicacid
CAS:<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H2Cl2N2O2Purity:Min. 95%Molecular weight:192.99 g/mol4-Oxo-1-adamantanecarboxylic acid
CAS:<p>4-Oxo-1-adamantanecarboxylic acid is a versatile building block that can be used as a reactant and reagent in organic chemistry. It is used to synthesize various heterocyclic compounds, including the 4-oxo-1,4-dihydropyridine ring system. This compound has been shown to be useful as an intermediate or building block in the synthesis of a number of complex compounds. 4-Oxo-1-adamantanecarboxylic acid may also be used as a research chemical or speciality chemical.</p>Formula:C11H14O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:194.23 g/molHIV-1 gag Protein p17 (76-84) acetate salt
CAS:<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>Formula:C44H72N10O15Purity:Min. 95%Molecular weight:981.1 g/mol4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester
CAS:<p>Please enquire for more information about 4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H23ClN2O3Purity:Min. 95%Molecular weight:374.86 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/mol2-Cyclohexyl-2-hydroxy-phenylacetic acid
CAS:<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>Formula:C14H18O3Purity:Min. 95%Molecular weight:234.29 g/molHemokinin 1 (human) trifluoroacetate salt
CAS:<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>Formula:C54H84N14O14SPurity:Min. 95%Molecular weight:1,185.4 g/molH-Phe-Met-D-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/mol(β-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H238N44O42SPurity:Min. 95%Molecular weight:3,325.8 g/molH-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H82N10O14Purity:Min. 95%Molecular weight:1,047.25 g/molH-Pro-Lys-OH acetate salt
CAS:<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>Formula:C11H21N3O3Purity:Min. 95%Molecular weight:243.3 g/mol(Deamino-Cys1,b-cyclohexyl-Ala4,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>Formula:C50H71N13O11S2Purity:Min. 95%Molecular weight:1,094.31 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molAnthranilyl-HIV Protease Substrate V trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H76N14O13Purity:Min. 95%Molecular weight:1,081.23 g/mol2-Methoxy-6-picolinic acid
CAS:<p>2-Methoxy-6-picolinic acid (2MPA) is a picolinate that has been shown to be an effective catalyst for the conversion of alcohols into allylic alcohols. 2MPA is able to catalyze the reaction by abstracting hydrogen from the carbonyl group, and then adding it to the adjacent carbon. This reaction can produce peroxide as a byproduct, which is subsequently hydrolyzed to form water and alcohol. The β-unsaturated carbonyl group of 2MPA provides additional stability for this catalytic process.<br>2MPA can also be used as a catalyst in other reactions, such as the oxidation of benzylic alcohols with hydrogen peroxide to form benzylic carbonyl compounds.</p>Formula:C7H7NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:153.14 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molTert-butyl 4-(3-hydroxypropyl)tetrahydro-1(2H)-pyridinecarboxylate
CAS:<p>Please enquire for more information about Tert-butyl 4-(3-hydroxypropyl)tetrahydro-1(2H)-pyridinecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25NO3Purity:Min. 95%Molecular weight:243.34 g/mol5,6-Dichloronicotinic acid
CAS:<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>Formula:C6H3Cl2NO2Color and Shape:PowderMolecular weight:192 g/mol4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid
CAS:<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>Formula:C13H18N2O2Purity:Min. 95%Molecular weight:234.29 g/mol(Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H82N14O18Purity:Min. 95%Molecular weight:1,179.28 g/molOxyntomodulin (bovine, dog, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C192H295N59O60SPurity:Min. 95%Molecular weight:4,421.82 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N12O13PPurity:Min. 95%Molecular weight:1,055.04 g/molL-Lysine acetate
CAS:Controlled Product<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>Formula:C8H18N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.24 g/mol2-(4-Chlorophenyl-acetyl)benzoic acid
CAS:<p>2-(4-Chlorophenyl-acetyl)benzoic acid is a fine chemical that is a versatile building block and useful intermediate. 2-(4-Chlorophenyl-acetyl)benzoic acid is used in the manufacture of other chemicals, such as pharmaceuticals, pesticides, dyes, or perfumes. It is also used for research purposes and as a reagent. It has a CAS number of 53242-76-5.</p>Formula:C15H11ClO3Purity:Min. 95%Color and Shape:PowderMolecular weight:274.7 g/mol5-Acenaphthenecarboxylic acid
CAS:<p>5-Acenaphthenecarboxylic acid is a xylene derivative that has been characterized as an organometallic compound. The cyclopentane ring is the central feature of this molecule and it can be used in the synthesis of other organic compounds. 5-Acenaphthenecarboxylic acid is toxic to humans and animals and has been shown to induce liver tumors in rats. It also has been shown to inhibit the growth of some bacteria, including Mycobacterium tuberculosis, which causes tuberculosis. 5-Acenaphthenecarboxylic acid inhibits protein synthesis by binding to ribosomes and interfering with the biosynthesis of proteins. This binding prevents formation of a complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>Formula:C13H10O2Purity:Min. 95%Color and Shape:PowderMolecular weight:198.22 g/molAc-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/molH-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N8O10Purity:Min. 95%Molecular weight:726.78 g/molMethyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H16N2O3SPurity:85%MinMolecular weight:292.35 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molRF9 trifluoroacetate salt
CAS:<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>Formula:C26H38N6O3Purity:Min. 95%Molecular weight:482.62 g/mol4-(Trimethylsilyl)pheNylboroNic acid
CAS:<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>Formula:C9H15BO2SiPurity:Min. 95%Molecular weight:194.11 g/molLinolenic acid - 98%
CAS:<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>Formula:C18H30O2Purity:Min. 95%Color and Shape:PowderMolecular weight:278.43 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molGalanin Message Associated Peptide (1-41) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C206H326N56O64SPurity:Min. 95%Molecular weight:4,643.2 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/molLQEQ-19 (human) trifluoroacetate salt
<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H170N30O34Purity:Min. 95%Molecular weight:2,408.67 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/molβ-MSH (human) trifluoroacetate salt
CAS:<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>Formula:C118H174N34O35SPurity:Min. 95%Molecular weight:2,660.92 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molH-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molGalnon trifluoroacetate salt
CAS:<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>Formula:C40H46N4O6Purity:Min. 95%Molecular weight:678.82 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/mol3-Cyanopropanoic acid
CAS:<p>3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:</p>Formula:C4H5NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:99.09 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/molOsteocalcin (1-49) (human) acetate salt
CAS:<p>Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.</p>Formula:C269H381N67O82S2Purity:Min. 95%Molecular weight:5,929.44 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/mol4-Chloro-Nicotinic acid ethyl ester hydrochloride
CAS:<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>Formula:C8H8ClNO2·HClPurity:Min. 95%Molecular weight:222.07 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/mol1H-Pyrrole-2,5-dicarboxylic acid
CAS:<p>1H-Pyrrole-2,5-dicarboxylic acid is a biosynthetic precursor of the amide functional group. It is synthesized from the carboxylic acid functional group and ferrocene. It has been shown to be a putative precursor of pyrrole-2-carboxylic acid in the pyrrole system. 1H-Pyrrole-2,5-dicarboxylic acid reacts with carbon tetrachloride and diethyl iminodiacetate in refluxing chloroform to produce coelicolor. The reaction mechanism for this transformation is unknown, but it is hypothesized that it involves a radical mechanism.</p>Formula:C6H5NO4Purity:Min. 95%Molecular weight:155.11 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molPAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H45N7O8Purity:Min. 95%Molecular weight:667.75 g/molH-His-Leu-His-bNA acetate salt
CAS:<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H34N8O3Purity:Min. 95%Molecular weight:530.62 g/mol(Dab 9)-Neurotensin (8-13) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H60N10O8Purity:Min. 95%Molecular weight:760.92 g/molEndotrophin (mouse) trifluoroacetate salt
CAS:<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>Formula:C345H520N92O106S7Purity:Min. 95%Molecular weight:7,876.84 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/molDefensin HNP-1 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.</p>Formula:C150H222N44O38S6Purity:Min. 95%Molecular weight:3,442.04 g/molAdropin (34-76) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H293N55O68S2Purity:Min. 95%Molecular weight:4,499.82 g/molOxindole-4-boronic acid, pinacol ester
CAS:<p>Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18BNO3Purity:Min. 95%Molecular weight:259.11 g/molO-Hippuryl-DL-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/molH-Gly-Gly-Arg-anilide acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H25N7O3Purity:Min. 95%Molecular weight:363.42 g/molD-Lactic acid benzyl ester
CAS:<p>D-Lactic acid benzyl ester is a chiral molecule that can be used as a feedstock for the production of D-lactic acid. It has been shown to catalyze hydrogenation reactions with an enhanced reaction rate and high selectivity when compared to other methods. The catalytic activity of D-lactic acid benzyl ester can be increased by using zeolites or iron catalyst, which are more expensive than the ligand used in this study. In addition, D-lactic acid benzyl ester was found to be more effective at catalysing the reaction between alkenes and hydrogen gas than other known catalysts. These findings indicate that it may be possible to use D-lactic acid benzyl ester as a cost-effective alternative to other catalysts in industrial processes.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/molHCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H116N20O17Purity:Min. 95%Molecular weight:1,425.72 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/mol(Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H76N14O11Purity:Min. 95%Molecular weight:1,097.27 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Formula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS:<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>Formula:C13H26N4O6Purity:Min. 95%Molecular weight:334.37 g/molSperm Peptide P10G trifluoroacetate salt
CAS:<p>Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H58N10O13Purity:Min. 95%Molecular weight:838.91 g/mol3-Acetyl-α-boswellic acid
CAS:<p>3-Acetyl-alpha-boswellic acid is a compound that has been derived from the plant Boswellia serrata. It has been shown to have antiinflammatory properties and may have clinical potential as an agent for the treatment of inflammatory diseases. 3-Acetyl-alpha-boswellic acid was found to inhibit the proliferation of myeloid leukemia cells, which were activated by cytokine stimulation. This compound also decreased the mitochondrial membrane potential in hl-60 cells, inhibited the plasma concentrations of proinflammatory cytokines, and had a two-way crossover study with healthy volunteers. In addition, it inhibits the production of 11-keto-beta-boswellic acid (KBA), which is a metabolite of 3AB that is associated with cancer progression. The antiinflammatory effects of 3AB are due to its ability to inhibit NFκB activation and downregulate IL1β and TNFα expression in leukemic cells.</p>Formula:C32H50O4Purity:Min. 95%Color and Shape:White PowderMolecular weight:498.74 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H36F3N7O11Purity:Min. 95%Molecular weight:751.66 g/molN,N'-Dibenzylethylenediamine diacetate
CAS:Controlled Product<p>N,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.</p>Formula:C16H20N2•(C2H4O2)2Purity:Min. 95%Molecular weight:360.45 g/molGastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C214H324N58O63SPurity:Min. 95%Molecular weight:4,749.28 g/mol([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2,7-Naphthalenedisulfonic acid disodium salt
CAS:<p>2,7-Naphthalenedisulfonic acid disodium salt is a heteronuclear molecule that is synthesized by the reaction of 2,7-naphthalenedisulfonyl chloride with sodium sulfite in water. It has been used in the manufacture of dyes and pigments, as a corrosion inhibitor for steel and aluminum, and as an intermediate in the synthesis of pharmaceuticals. The compound has been detected in groundwater samples at concentrations up to 10 mg/L. The compound is also found in geothermal waters at concentrations up to 0.6 mg/L.</p>Formula:C10H6Na2O6S2Purity:Min. 95%Molecular weight:332.26 g/mol4-Nitro benzenebutanoic acid
CAS:<p>4-Nitro benzenebutanoic acid is a synthetic molecule that has not been extensively studied in biological systems. It is a calcium-binding molecule and may be used to study the mechanisms of calcium binding. 4-Nitrobenzenebutanoic acid has also shown some bifunctional activity and is used as a substrate in pharmacokinetic studies. The synthesis of this compound can be achieved by reacting azobenzene with butyric acid in the presence of an amine and inulin. This reaction produces nitrobenzenebutanoic acid, which undergoes hydrolysis to yield 4-nitrobenzenebutanoic acid.</p>Formula:C10H11NO4Purity:Min. 95%Molecular weight:209.2 g/molNeuropeptide VF (56-92) (human) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H304N52O51S2Purity:Min. 95%Molecular weight:4,256.95 g/molBiotinyl-Hepcidin-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H184N36O33S10Purity:Min. 95%Molecular weight:3,015.66 g/mol3,4-Dibromobenzoic acid ethyl ester
CAS:<p>3,4-Dibromobenzoic acid ethyl ester is a high quality reagent that can be used as an intermediate for the synthesis of complex compounds. It is also useful as a building block for the synthesis of speciality chemicals and research chemicals. 3,4-Dibromobenzoic acid ethyl ester can be used in reactions such as Friedel-Crafts reactions, reducing reactions, and condensations. This chemical is a versatile building block that can be used to construct organic molecules with diverse structures. 3,4-Dibromobenzoic acid ethyl ester is a fine chemical with CAS number 60469-88-7.</p>Formula:C9H8Br2O2Purity:Min. 95%Molecular weight:307.97 g/mol(Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C169H279N53O51S2Purity:Min. 95%Molecular weight:3,933.48 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/molAcetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H63N9O8Purity:Min. 95%Molecular weight:822.01 g/mol
