Carboxylic Acids

<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br&gt;<br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>

<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>

<p>Intermediate in the synthesis of afatinib</p>

<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>

<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 2-fluoroacetoacetate is a phosphorus oxychloride synthon that can be used to synthesize fluorinated compounds. It has been shown to react with a carbonyl group, like tyrosine, in the presence of an organocatalyst to form a tetrafluoroborate ester. The reaction mechanism of this compound is intramolecular hydrogen transfer from the phosphite oxygen atom to the electrophilic carbon atom. Ethyl 2-fluoroacetoacetate has been shown to react with alkyl halides and hydroxyl groups in the presence of base, forming enantiomeric alcohols. This compound has also been shown to have optical properties that are stable at room temperature and pressure, including infrared absorption maxima at 1740 cm-1 and 1775 cm-1 as well as ultraviolet absorption maxima at 225 nm and 254 nm.</p>

<p>Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.</p>

<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>3-Bromophenyl boronic acid is a group P2 molecule with functional groups of vibrational and cross-coupling. It has been shown to inhibit the activity of aryl boronic acids, which are commonly used in analytical methods. 3-Bromophenyl boronic acid is also capable of inhibiting the production of alizarin, which is a dye that is used for staining biological tissue. The molecular modeling study revealed that this molecule has an atomic orbital with electron density distribution around the central carbon atom. This distribution indicates that it is more stable than other molecules with similar structures.</p>

<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>

<p>Please enquire for more information about Salusin-alpha (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Isoascorbic acid is a sodium salt of ascorbic acid. It is used for the prevention and treatment of scurvy, which is caused by vitamin C deficiency. D-Isoascorbic acid functions as an electron donor in biochemical reactions and has been shown to have physiological effects. Ascorbic acid (vitamin C) is a water-soluble antioxidant that can react with hydrogen fluoride in vitro to form free radicals that may cause damage to cells. In addition, D-Isoascorbic acid can be used as a model system for the study of ascorbic acid and p-hydroxybenzoic acid. The analytical method for determining these compounds involves electrochemical impedance spectroscopy.</p>

<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>

<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,4-Dinitrophenylacetic acid is a chemical substance with the potential to inhibit acetylation. It can be used as an antigen and has been detected in environmental chemistry. 2,4-Dinitrophenylacetic acid is produced by the reaction of chemicals that are found in the environment and it can be detected at low concentrations. This compound is able to react with proteins in cells, leading to high cytotoxicity. 2,4-Dinitrophenylacetic acid can also stabilize optical systems.</p>

<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>

<p>Please enquire for more information about 1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>

<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>

<p>Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.</p>

<p>Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>

<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>

<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>