
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid
CAS:<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H35FN2O7Purity:Min. 95%Molecular weight:590.64 g/molBIM-23627 trifluoroacetate salt
CAS:<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O8S2Purity:Min. 95%Molecular weight:1,161.83 g/molAmyloid β-Protein (1-24) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H183N35O40Purity:Min. 95%Molecular weight:2,876.06 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37Purity:Min. 95%Molecular weight:2,763.07 g/mol(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H281N57O54S2Purity:Min. 95%Molecular weight:4,207.67 g/mol[2-fluoro-4-(trifluoromethyl)phenyl]boronic Acid
CAS:<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>Formula:C7H5BF4O2Purity:Min. 95%Molecular weight:207.92 g/molH-Asn-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Asn-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O4Purity:Min. 95%Molecular weight:289.29 g/mol(Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%SPLUNC1 (22-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O25Purity:Min. 95%Molecular weight:1,815.08 g/mol5-Aminopyridine-3-carboxylic acid
CAS:<p>5-Aminopyridine-3-carboxylic acid (5APC) is a structural analog of nicotinic acid that has been shown to have anti-inflammatory effects. 5APC inhibits the production of inflammatory cytokines, such as IL-10 and IL-17, by inhibiting the activation of NFκB and MAPK pathways. This drug also has significant inhibitory activities against dextran sulfate sodium (DSS)-induced acute colitis in experimental models. 5APC is thought to act by interrupting the assembly of p38 mitogen activated protein kinase (MAPK) and nuclear factor kappa B (NFκB) signaling complexes.</p>Formula:C6H6N2O2Purity:Min. 95%Molecular weight:138.12 g/mol4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H33BN2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:388.31 g/molFibronectin Fragment (1954-1959) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H63N11O7Purity:Min. 95%Molecular weight:713.91 g/molMethylboronic acid pinacol ester
CAS:<p>Methylboronic acid pinacol ester is an orally administered compound that inhibits the activity of peptidases and imidazole derivatives. It is used as a medicinal preparation for the treatment of cancer and other diseases. Methylboronic acid pinacol ester has been shown to inhibit the growth of bacteria, including Gram-positive bacteria such as methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens. This compound also has an inhibitory effect on hydroxyl group metabolism, which may be related to its anti-inflammatory properties.</p>Formula:C7H15BO2Purity:Min. 95%Color and Shape:Colourless liquid.Molecular weight:142 g/molOsteogenic Growth Peptide (10-14) trifluoroacetate salt
CAS:<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>Formula:C24H29N5O7Purity:Min. 95%Molecular weight:499.52 g/molAmylin (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C167H272N52O53S2Purity:Min. 95%Molecular weight:3,920.4 g/mol2,4,6-Trifluorobenzoic acid
CAS:<p>2,4,6-Trifluorobenzoic acid is a chemical compound that is an intermediate in the synthesis of stilbazole. It is prepared by chlorinating the 2,4,6-trichlorobenzoic acid with hydrogen peroxide and hydrochloric acid. The 2,4,6-trifluorobenzoic acid is then reduced to the desired product with sodium borohydride. This chemical has been detected in nature as a racemic mixture and can be used as a precursor in analytical methods for detecting other compounds. It is also used in dechlorination reactions to remove chlorine from organic molecules. This process can be monitored using UV detectors.</p>Formula:C7H3F3O2Purity:Min. 95%Molecular weight:176.09 g/mol3-Pyridylboronic acid pinacol ester
CAS:<p>3-Pyridylboronic acid pinacol ester is a versatile reagent that can be used in the synthesis of polymers with reactive functionalities. This compound is a crosslinker, which means that it reacts with two or more other molecules to form a covalent bond. 3-Pyridylboronic acid pinacol ester has been shown to react with ring-opening methacrylate monomers and expand their polymer backbone, which leads to an increase in the number of reactive groups on the chain. The introduction of 3-pyridylboronic acid pinacol ester can also introduce fluorescent units into polymers for use as probes for biological systems. There are many possible applications for this versatile reagent, including its use in the synthesis of imidazopyridine ligands.</p>Formula:C11H16BNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:205.06 g/molBenzimidazole-5-carboxylic acid
CAS:<p>Benzimidazole-5-carboxylic acid is a monoclonal antibody that binds to the amide group of an amino acid. It has been shown to be a potent inhibitor of cell growth in cervical cancer cells and rat liver microsomes. It also showed inhibitory activity against fatty acid and nucleotide synthesis. Benzimidazole-5-carboxylic acid is a benzimidazole compound that has been shown to have anti-inflammatory effects in animal models and also inhibits the replication of HIV. This drug can inhibit the replication of influenza A virus in vitro and may be useful as an antiviral agent for treatment of influenza A infection.</p>Formula:C8H6N2O2Purity:Min. 98%Color and Shape:PowderMolecular weight:162.15 g/molMca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H110N22O20Purity:Min. 95%Molecular weight:1,675.84 g/molTRAF6 Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H238N34O44Purity:Min. 95%Molecular weight:3,161.64 g/mol5-Methylpyrimidine-2-carboxylic acid
CAS:<p>Please enquire for more information about 5-Methylpyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6N2O2Purity:Min. 95%Molecular weight:138.12 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/molCell-permeable Caspase-3 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-3 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C94H158N20O27Purity:Min. 95%Molecular weight:2,000.38 g/mol2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt
CAS:<p>2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt (2HMP) is a diagnostic agent that can be used for the detection of bacterial infections. The conformational properties of 2HMP are similar to those of ATP, which allows it to bind to the polymerase chain reaction enzyme and initiate an enzymatic reaction. This leads to the production of a signal that can be detected by spectrophotometry or fluorometry. 2HMP has also been shown to have chemokine activity in vitro, but this has not been tested in vivo. 2HMP is a competitive inhibitor of human protein serine proteases, such as trypsin and chymotrypsin, with an IC50 value of approximately 1 μM.</p>Formula:C3H7NaO4S2Purity:Min. 95%Molecular weight:194.2 g/molAc-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H66N6O11SPurity:Min. 95%Molecular weight:851.06 g/molCyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt
CAS:<p>Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt is a potent inhibitor of the enzyme kallikrein, which is involved in the production of kinins. It has been shown to inhibit bradykinin breakdown by inhibiting kallikrein and thus prolonging the effects of this hormone. Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt also inhibits aldosterone levels in plasma and reduces glucocorticoid levels, which may be due to its ability to inhibit plasma renin concentrations.</p>Formula:C36H58N10O8Purity:Min. 95%Molecular weight:758.91 g/molAmyloid β-Protein (1-37) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H274N50O55SPurity:Min. 95%Molecular weight:4,074.49 g/mol(Asp28)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H281N49O61SPurity:Min. 95%Molecular weight:4,187.56 g/molNeuromedin U-23 (rat) trifluoroacetate salt
CAS:<p>Neuromedin U-23 (rat) is a peptide that belongs to the family of tachykinins, which are small neuropeptides that act as neurotransmitters in the central nervous system. It is a potent stimulator of intestinal motility and has been shown to have protective effects against oxidative stress in cells. Neuromedin U-23 (rat) shares sequence similarity with human neuromedin N-19 and binds to the same receptors in the brain, suggesting it may have similar physiological effects. This peptide has been shown to inhibit tumor cell growth by inducing apoptosis, but it does not appear to have any effect on healthy cells.</p>Formula:C124H180N34O31Purity:Min. 95%Molecular weight:2,642.97 g/mol(D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H99N19O15Purity:Min. 95%Molecular weight:1,338.56 g/molBiotinyl-Neuropeptide W-23 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H197N37O30S2Purity:Min. 95%Molecular weight:2,810.31 g/mol(Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt
<p>Please enquire for more information about (Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C266H381N67O76S2Purity:Min. 95%Molecular weight:5,797.41 g/molDefensin HNP-2 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-2 is a peptide that has been shown to bind to cancer cells, metabolic disorders, and endometriosis. It also has pharmaceutical preparations for treating microbial infection and other diseases. Defensin HNP-2 is a broad-spectrum antimicrobial peptide and it binds to bacterial membranes in the cell cytoplasm. Defensin HNP-2 may be used as diagnostic agents or in the treatment of microbial infections. This antimicrobial peptide is stable when complexed with calcium ions and can be used against s. aureus strains that are resistant to antibiotics such as ciprofloxacin.</p>Formula:C147H217N43O37S6Purity:Min. 95%Molecular weight:3,370.96 g/molFibrinopeptide A (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>Formula:C63H97N19O26Purity:Min. 95%Molecular weight:1,536.56 g/molEthylene glycol monoacetoacetate monomethacrylate
CAS:<p>Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size of</p>Formula:C10H14O5Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:214.22 g/molc3-Ethylbenzoic acid
CAS:<p>C3-Ethylbenzoic acid is an organic compound that can be synthesized from the reactants ethyl bromide, propylene oxide, and acetic anhydride. The synthesis of C3-Ethylbenzoic acid is a stepwise process in which the starting materials are converted to intermediates and then reacted to form the desired product. The reaction mechanism involves bond cleavage, which generates a carboxylic acid group on one end of the molecule and a phenyl group on the other end. C3-Ethylbenzoic acid interacts with clausamine and isoprene during transport through cell membranes. This interaction may lead to increased permeability of cell membranes by c3-ethylbenzoic acid.</p>Formula:C9H10O2Purity:Min. 95%Molecular weight:150.17 g/molH-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H61N9O7S2·C2HF3O2Purity:Min. 95%Molecular weight:970.13 g/mol(S)-(1-boc-pyrrolidin-3-yl)-acetic acid
CAS:<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molHel 13-5 trifluoroacetate salt
CAS:Controlled Product<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formula:C113H204N24O19Purity:Min. 95%Molecular weight:2,202.98 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Formula:C32H49N5O7•C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:675.81 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Formula:C30H44N8O4Purity:Min. 95%Molecular weight:580.72 g/mol(D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/molH-D-Val-Leu-Lys-AMC acetate salt
CAS:<p>Please enquire for more information about H-D-Val-Leu-Lys-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H41N5O5Purity:Min. 95%Molecular weight:515.65 g/mol3-Bromo-6-methylpicolinic acid
CAS:<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H6BrNO2Purity:Min. 95%Molecular weight:252.49 g/molBradykinin (2-9) acetate salt
CAS:<p>Acetate salt</p>Formula:C44H61N11O10Purity:Min. 95%Molecular weight:904.02 g/molH-Pro-Pro-Asp-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H22N4O5·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:440.37 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/mol2,7-Naphthalenedicarboxylicacid
CAS:<p>2,7-Naphthalenedicarboxylic acid is a synthetic compound that belongs to the group of aromatic hydrocarbons. It has been shown to have magnetic resonance spectroscopy (MRS) and X-ray structures that are similar to those of phenyl substituents. 2,7-Naphthalenedicarboxylic acid also shows supramolecular interactions with other molecules. The asymmetry can be explained by the presence of a nitrogen atom in the molecule, which can form intramolecular hydrogen bonds.</p>Formula:C12H8O4Purity:Min. 95%Molecular weight:216.19 g/molPrion Protein (118-135) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H112N18O22S2Purity:Min. 95%Molecular weight:1,597.86 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H276N54O55SPurity:Min. 95%Molecular weight:4,108.51 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H183N45O26Purity:Min. 95%Molecular weight:2,455.83 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H105N17O12SPurity:Min. 95%Molecular weight:1,384.73 g/molDiethyldithiocarbamic acid sodium trihydrate
CAS:<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>Formula:C5H11NS2•Na•(H2O)3Purity:Min. 95%Color and Shape:PowderMolecular weight:226.32 g/molBiotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C119H192N38O22S2Purity:Min. 95%Molecular weight:2,571.17 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N9O8·xC2H4O2Purity:Min. 95%Molecular weight:725.84 g/mol(Pyr 1)-Opiorphin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H45N11O8Purity:Min. 95%Molecular weight:675.74 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H294N54O56Purity:Min. 95%Molecular weight:4,278.74 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C61H83N15O10Purity:Min. 95%Molecular weight:1,186.41 g/mol4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid
CAS:<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>Formula:C9H9BrN2O3Purity:(Elemental Analysis) Min. 97%Color and Shape:PowderMolecular weight:273.08 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS:<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>Formula:C7H8N2O2·xHClPurity:(%) Min. 60%Color and Shape:PowderMolecular weight:188.61 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H78N14O19Purity:Min. 95%Molecular weight:1,179.24 g/mol7-Hydroxynaphthalene-1-sulfonic acid
CAS:<p>7-Hydroxynaphthalene-1-sulfonic acid is a chemical compound with the formula HNSO. It is an organic compound and a proton acceptor. The conjugate base of 7-hydroxynaphthalene-1-sulfonic acid has a strong absorption band in the ultraviolet region. In DMF solution, the reaction of 7-hydroxynaphthalene-1-sulfonic acid with formamide, hydroxy, and nitrogen atoms produces a product that has been characterized by photoexcitation and kinetic studies. The proton transfer process from formamide to 7-hydroxynaphthalene-1-sulfonic acid was found to be exponential and followed first order kinetics. The protonation constant for this process was determined to be 8.4 x 10 M/equivalent. 7HNSO can also act as an electron acceptor in dimethylsulphoxide (DMSO) solution</p>Purity:Min. 95%(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H295N55O51S2Purity:Min. 95%Molecular weight:4,217.84 g/mol(Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H86N16O13Purity:Min. 95%Molecular weight:1,251.44 g/molLysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Formula:C72H116N22O29Purity:Min. 95%Molecular weight:1,753.82 g/molOleic acid
CAS:<p>Oleic acid is a naturally occurring monounsaturated fatty acid (C18:1, cis-9-octadecenoic acid) widely used as an excipient in pharmaceutical formulations. Due to its amphiphilic and lipophilic properties, oleic acid is an important drug excipient primarily used to enhance the solubility and bioavailability of poorly water-soluble drugs. As a fatty acid, it is widely used in cosmeceuticals as it acts as a solubilizer in lipid-based systems, an emulsifier in creams and ointments, and a penetration enhancer in transdermal patches, aiding drug absorption through the skin.</p>Formula:C18H34O2Color and Shape:Colorless Clear Liquid PowderMolecular weight:282.46 g/mol2-Fluoro-6-methylbenzoic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H7FO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:154.14 g/molLinoleic acid - powder
CAS:<p>Linoleic acid is a polyunsaturated fatty acid that is an important component of cell membranes. It has been shown to inhibit oxidative injury and improve mitochondrial functions. Linoleic acid also has a role in energy metabolism, as it is the precursor for biosynthesis of eicosanoids and arachidonic acid. The physiological effects of linoleic acid have been studied using a model system consisting of isolated rat adipose tissue and mitochondria. This model system has been used to investigate the inhibitory properties of linoleic acid on caproic acid-induced lipid peroxidation. Linoleic acid has also been shown to have anion radical scavenging activity when in the presence of iron. This compound can be analyzed using gas chromatography-mass spectrometry (GC-MS) based on its chemical composition, which consists mainly of linear 18-carbon chains with two double bonds at positions 9 and 12.</p>Formula:C18H32O2Purity:Min. 95%Color and Shape:PowderMolecular weight:280.45 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/molH-Lys-Tyr-OH acetate salt
CAS:<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molAngiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/mol2-Chloropyridine-4-boronic acid
CAS:<p>2-Chloropyridine-4-boronic acid is a nicotinic acetylcholine receptor antagonist that has been shown to be effective against trypanosomiasis. It blocks the binding of acetylcholine to its receptor, which prevents the propagation of an action potential in the postsynaptic cell. 2-Chloropyridine-4-boronic acid inhibits the enzymes cyclooxygenase and prostaglandin synthase, which are involved in inflammation. 2-Chloropyridine-4-boronic acid is potent and selective for nicotinic acetylcholine receptors, but it also binds to other sites on the enzyme. The molecular modeling studies have shown that this compound has a pharmacophore that can be used as a guide for drug design.</p>Formula:C5H5BClNO2Purity:Min. 95%Molecular weight:157.36 g/molH-Val-Ile-His-Thr-EDANS acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H48N8O8SPurity:Min. 95%Molecular weight:716.85 g/molDocosahexaenoic acid ethyl ester
CAS:<p>Docosahexaenoic acid ethyl ester (DHAEE) is a biologically active form of docosahexaenoic acid (DHA), which is an omega-3 polyunsaturated fatty acid. DHAEE is synthesized from DHA through the process of acylation with ethanol. It has been shown to have antioxidant and anti-inflammatory properties in animal studies, as well as improved brain functions. When given to rats, it prevents neuronal death and has been shown to reduce the risk of congestive heart failure.</p>Formula:C24H36O2Purity:Min. 95%Color and Shape:Colorless Yellow Clear LiquidMolecular weight:356.54 g/molH-Arg-Arg-Arg-Arg-OH acetate salt
CAS:<p>Acetate salt</p>Formula:C24H50N16O5Purity:Min. 95%Molecular weight:642.76 g/mol1H-Indazole-5-boronic acid
CAS:<p>1H-Indazole-5-boronic acid is a potent compound that belongs to the class of indazole compounds. It has been shown to inhibit protein phosphorylation and induce morphological changes in cells. This compound also inhibits the activity of a number of different cellular enzymes, including protein phosphatases, protein kinases, and protein tyrosine phosphatases. 1H-Indazole-5-boronic acid has been shown to be a promising lead compound for the discovery of novel inhibitors of these enzymes.</p>Formula:C7H7BN2O2Purity:Min. 95%Molecular weight:161.95 g/mol1-Methyl-1H-imidazole-5-carboxylic acid
CAS:<p>1-Methyl-1H-imidazole-5-carboxylic acid is an amide that is used as a hardener in medicines. It can be synthesized by the reaction of ethyl formate with thionyl chloride and imidazoles. The yield of this product is high, and it can be produced in different stereoisomeric forms. 1-Methyl-1H-imidazole-5-carboxylic acid is used to produce other medicines, such as painkillers, tranquilizers, diuretics, and antibiotics. This product has been shown to have a number of health benefits, including reducing cholesterol levels and blood pressure.</p>Formula:C5H6N2O2Purity:Min. 95%Molecular weight:126.11 g/moltert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 4,7-diazaspiro[2.5]octane-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Enterotoxin STp (E. coli) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H110N20O26S6Purity:Min. 95%Molecular weight:1,972.26 g/molβ-Casomorphin (1-4) (bovine) acetate salt
CAS:<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>Formula:C28H34N4O6Purity:Min. 95%Molecular weight:522.59 g/mol(Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt
CAS:<p>Please enquire for more information about (Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H75N13O9Purity:Min. 95%Molecular weight:918.14 g/mol(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H283N51O53SPurity:Min. 95%Molecular weight:4,125.63 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molNeuropeptide EI (human, mouse, rat) trifluoroacetate salt
CAS:<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>Formula:C63H98N16O23Purity:Min. 95%Molecular weight:1,447.55 g/mol(Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molAQEE-30 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H245N47O56Purity:Min. 95%Molecular weight:3,674.9 g/mol(D-Trp8)-γ2-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/molH-Gly-Gly-Lys-Ala-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N6O6Purity:Min. 95%Molecular weight:402.45 g/molEthyl 4-methoxyphenylacetate
CAS:<p>Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.</p>Formula:C11H14O3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:194.23 g/molZ-Val-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H36N8O7Purity:Min. 95%Molecular weight:584.62 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H51N11O7•C2HF3O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:839.86 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/molAdrenomedullin 5 (primate) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin 5 (primate) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C253H394N82O71S2Purity:Min. 95%Molecular weight:5,784.48 g/molPAR-2 (1-6) amide (human) trifluoroacetate salt
CAS:<p>PAR-2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-NH2 trifluoroacetate salt is a protease inhibitor that inhibits the activity of PAR2, a protein receptor. PAR2 is implicated in cancer and inflammation. It has been shown to inhibit growth factor signaling, as well as activate toll-like receptor 4 and other inflammatory pathways. PAR2 inhibition has also been studied in vivo and found to be effective in treating wild type mice with melanoma cells. In vitro studies have shown that PAR2 inhibition by PAR 2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val NH2 trifluoroacetate salt blocks the production of tumour necrosis factor alpha and interleukin 6.</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/mol1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H24N4O4Purity:Min. 95%Molecular weight:360.41 g/mol4-Hydroxyphenyl acetate
CAS:<p>4-Hydroxyphenyl acetate is a naturally occurring fatty acid that is found in many plants. It has been isolated from the seeds of Telfairia occidentalis and has been shown to inhibit the growth of bacteria at a pH of 7.5, with an optimal pH of 8.0. 4-Hydroxyphenyl acetate is an activated form of this compound, which means it contains two hydroxyl groups and does not have to be synthesized by enzymes. 4-Hydroxyphenyl acetate inhibits bacterial enzyme activities such as DNA gyrase and RNA polymerase, which are necessary for transcription and replication. The structure analysis of 4-hydroxy phenylacetate was determined using trifluoroacetic acid (TFA) on a wild-type strain of Escherichia coli K12.</p>Formula:C8H8O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:152.15 g/mol2-Amino-5-chloro-3-methylbenzoic acid
CAS:<p>2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.</p>Formula:C8H8ClNO2Purity:Min. 95%Molecular weight:185.61 g/mol(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid
CAS:<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>Formula:C12H15NO5Purity:Min. 95%Molecular weight:253.25 g/molMAGE-1 Antigen (161-169) (human) acetate salt
CAS:<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>Formula:C41H57N11O17Purity:Min. 95%Molecular weight:975.96 g/molEndomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/mol6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C247H361N57O80S2Purity:Min. 95%Molecular weight:5,472.98 g/molRVG-9R trifluoroacetate salt
CAS:<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C201H334N82O55S2Purity:Min. 95%Molecular weight:4,843.45 g/molH-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt
<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N14O16SPurity:Min. 95%Molecular weight:1,051.09 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molBiphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Formula:C46H56N10O10Purity:Min. 95%Molecular weight:909 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/mol(2-Chlorophenyl)boronic acid
CAS:<p>2-Chlorophenylboronic acid is a diphenyl ether that can be used as a building block for the synthesis of benzodiazepine receptor ligands. It has been shown to be an efficient nucleophile, leading to the formation of carbonyl groups in the presence of halides. 2-Chlorophenylboronic acid has also been shown to inhibit p38 kinase activity and may be useful for anticancer therapy.</p>Formula:C6H6BClO2Purity:Min. 95%Molecular weight:156.37 g/molDiphenolic acid
CAS:<p>Diphenolic acid is a reactive compound that is used as a solid catalyst. It has a hydroxyl group and a fatty acid, which makes it soluble in organic solvents. The methyl ethyl ester of diphenolic acid can be obtained from the reaction of diphenolic acid with methanol, ethanol or ethylene glycol. Diphenolic acid can also be obtained by reacting dibenzalacetone with an alcohol.<br>Diphenolic acid has been used to synthesize monoclonal antibodies and linear calibration curves for electrochemical impedance spectroscopy. The hydroxyl group on diphenolic acid allows it to undergo reactions that are not possible for other compounds such as phenols, leading to its use in surface methodology and flow systems.</p>Formula:C17H18O4Color and Shape:White PowderMolecular weight:286.32 g/molPHM-27 (human) trifluoroacetate salt
CAS:<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>Formula:C135H214N34O40SPurity:Min. 95%Molecular weight:2,985.41 g/mol1-Adamantylphosphonic acid
CAS:<p>1-Adamantylphosphonic acid (1APA) is a trifluoroacetic acid derivative that is used as an organic solvent. It is also a catalyst in organic chemistry. 1APA can be used to catalyze the carbonylation of olefins with phosphines, which are ligands that bind to metal compounds and facilitate chemical reactions. Ferrocene, adamantyl, and metallocene are all examples of ligands. 1APA is also used as a reagent in the synthesis of phosphine ligands, which are used in catalytic reactions.</p>Formula:C10H17O3PPurity:Min. 95%Molecular weight:216.21 g/molα-MSH (11-13) (free acid) acetate salt
CAS:<p>α-MSH (11-13) (free acid) acetate salt is a synthetic, nonsteroidal compound that binds to and activates α-melanocyte-stimulating hormone receptors. It has been used as an antiinflammatory agent in the treatment of inflammatory bowel disease and bowel disease. α-MSH (11-13) (free acid) acetate salt is also being studied as a contraceptive and an elastase inhibitor. This drug has shown some promise in the treatment of autoimmune diseases, such as rheumatoid arthritis, Crohn's disease, ulcerative colitis, multiple sclerosis, and type 1 diabetes mellitus. It is thought that α-MSH (11-13) (free acid) acetate salt may inhibit the production of inflammatory cells by inhibiting leukocyte elastase activity.</p>Formula:C16H30N4O4Purity:Min. 95%Molecular weight:342.43 g/molMethyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate
CAS:<p>Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%N-(2-Pyridyl)oxamic acid
CAS:<p>N-(2-Pyridyl)oxamic acid is a non-steroidal anti-inflammatory drug that belongs to the group of piroxicam. It was found to be a competitive inhibitor of the reaction between singlet oxygen and certain organic compounds. The reaction rate of N-(2-pyridyl)oxamic acid is dependent on the concentration of solvent, which affects the solvation of the reactants and products. The tautomerization equilibrium constant for N-(2-pyridyl)oxamic acid has been determined as 1.3 × 10 at 25°C in acetonitrile, with an apparent molecular weight of 251.6 g/mol. The singlet oxygen constant (Ks) for this compound is 2.8 × 10 at 25°C in acetonitrile, with a maximum absorbance wavelength at 295 nm and a half life time of 0.27 seconds at 298 K in pure water.</p>Formula:C7H6N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:166.13 g/mol4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester
CAS:<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12BrNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:302.12 g/molLysergic acid hydrazide
CAS:Controlled Product<p>Lysergic acid hydrazide is a synthetic drug with an active form of lysergic acid. It is used in the synthesis of ergocryptine and other drugs. The compound can be synthesized using methyl alcohol, trifluoromethyl group, hydroxy group, skeleton, and C1-4 alkyl as reactants. Lysergic acid hydrazide can also be synthesized from an inorganic acid such as nitrous or oxoalkyl. This compound has been used as a pharmaceutical preparation for the treatment of psychotic disorders. Lysergic acid hydrazide has shown to have reactive amide groups that may react with organic amines to form neurotoxic compounds.</p>Formula:C16H18N4OPurity:Min. 95%Molecular weight:282.34 g/molTES
CAS:<p>TES, also known as N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid, is a buffering agent that is used in protein assays and forms complexes with DNA and copper ions. The optimal pH range of this zwitterionic buffer is 6.8-8.2 and its pKa is 7.4.</p>Formula:C6H15NO6SPurity:Min. 95%Color and Shape:PowderMolecular weight:229.25 g/mol(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride
CAS:<p>(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.</p>Formula:C12H15NO4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:273.71 g/molAngiotensin A (1-7) trifluoroacetate
CAS:<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/mol4-[2-[[(1S)-1-(2-Aminophenyl)-3-methylbutyl]amino]-2-oxoethyl]-2-ethoxybenzoic acid
CAS:<p>Bosentan is a potent inhibitor of the uptake of organic anions. It is used in the treatment of pulmonary arterial hypertension and has been shown to be effective against pravastatin-resistant HIV protease inhibitors, such as saquinavir, quinidine, and rosuvastatin. Bosentan inhibits uptake by binding to the transporter protein at a site that does not overlap with the binding site for organic anion substrates. This leads to a change in kinetic parameters for substrates, such as pravastatin and saquinavir. The binding site on bosentan may also be elucidated through monolayer experiments with efflux transporters.</p>Formula:C22H28N2O4Purity:Min. 95%Molecular weight:384.47 g/mol5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride
CAS:<p>Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H12N2O4•HClPurity:Min. 95%Molecular weight:248.66 g/mol2-Bromopropionic acid benzyl ester
CAS:<p>2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).</p>Formula:C10H11BrO2Purity:Min. 95%Molecular weight:243.1 g/molAmylin (free acid) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H260N50O56S2Purity:Min. 95%Molecular weight:3,904.27 g/mol5,7-Docosadiynoic acid
CAS:<p>5,7-Docosadiynoic acid is a fluorescent molecule that has been found to have low molecular weight, which makes it ideal for use in a variety of strategies. This compound can be used as a fluorescent probe for the detection of membrane interactions and also has many potential applications in polymerized optical devices. 5,7-Docosadiynoic acid is able to fluoresce when irradiated with light at wavelengths above 500 nm and has been shown to be excited by UV light. The chemical properties of 5,7-docosadiynoic acid make it an excellent candidate for use in sensors and optical devices.</p>Formula:C22H36O2Purity:Min. 95%Molecular weight:332.52 g/molIsopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate
CAS:<p>Please enquire for more information about Isopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H16N4O3Purity:Min. 95%Molecular weight:252.27 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS:<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>Formula:C34H38N8O9Purity:Min. 95%Color and Shape:PowderMolecular weight:702.71 g/molH-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>Formula:C14H25ClN6O5Purity:Min. 95%Molecular weight:392.84 g/molThymopentin acetate salt
CAS:Controlled Product<p>Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.</p>Formula:C30H49N9O9Purity:Min. 95%Molecular weight:679.77 g/molN,N-Bis(carboxymethyl)-L-glutamic acid
CAS:<p>N,N-bis(Carboxymethyl)-L-glutamic acid is a synthetic compound that functions as a disinfectant. It has been shown to be effective against bacteria and fungi in vitro, with an efficacy of over 90%. N,N-bis(Carboxymethyl)-L-glutamic acid is used as a treatment for tumors due to its ability to penetrate the tumor cells and inhibit fatty acid uptake. This compound also prevents the formation of new blood vessels by inhibiting the synthesis of DNA and RNA. N,N-bis(Carboxymethyl)-L-glutamic acid can be used in coatings for metals or metal surfaces that are exposed to water or air because it is biodegradable and noncorrosive.</p>Formula:C9H13NO8Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:263.2 g/moltert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate
CAS:<p>tert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate is a chiral compound that contains two stereogenic centers. It is a racemate of enantiomers. The enantiomeric purity can be determined by the preparative method. This compound is soluble in water and is stable in neutral or acidic conditions. It has been shown to act as an α-amino acid and to inhibit glycine uptake by neurons.</p>Formula:C21H23NO4Purity:Min. 95%Color and Shape:SolidMolecular weight:353.41 g/mol3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid
CAS:<p>3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is a versatile building block for the synthesis of complex compounds. It is used as a reagent to make other chemicals and has been used in the synthesis of research chemicals. 3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is also useful as an intermediate or scaffold compound in organic chemistry. This product has high purity and quality.</p>Formula:C14H16O3Purity:Min. 95%Molecular weight:232.28 g/mol2-(2-Naphthyloxy)propanoic acid
CAS:<p>2-(2-Naphthyloxy)propanoic acid is a naphthalene derivative that is found in the plant species Carthamus tinctorius. It has been shown to have potent antagonist activity against the NMDA receptor, as well as antinociceptive and analgesic properties in vivo. 2-(2-Naphthyloxy)propanoic acid also shows potent anti-inflammatory and cardioprotective effects in vitro and in vivo. 2-(2-Naphthyloxy)propanoic acid can be used for the treatment of bone cancer, congestive heart failure, diabetic neuropathy, or other disorders of the peripheral nervous system.</p>Formula:C13H12O3Purity:Min. 95%Molecular weight:216.23 g/molGlycodehydrocholic acid
CAS:Controlled Product<p>Glycodehydrocholic acid is a bile acid that is synthesized from cholesterol by the liver and intestine. It is used for the diagnosis of cancer and other medical conditions, such as obesity. Glycodehydrocholic acid inhibits the growth of adipose tissue cells, which may be due to its ability to increase the expression of genes related to lipid metabolism. This drug has also been shown to have an inhibitory effect on mitochondria and tumor cells in human serum. Glycodehydrocholic acid can be measured using chromatographic methods with a sample preparation before analysis. This drug can also be detected in urine samples by gas-liquid chromatography or mass spectrometry. The metabolic profiles of women differ from men, so it is important to take this into account when performing analytical chemistry procedures on this compound.</p>Formula:C26H37NO6Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:459.58 g/molD-(-)-3-Phosphoglyceric acid disodium
CAS:<p>D-(-)-3-Phosphoglyceric acid disodium is a homologue of D-glyceric acid and is used in the synthesis of phosphatidylcholine. It binds to the active site of phosphatases and prevents them from hydrolyzing phosphate groups, which are critical for the production of adenosine triphosphate (ATP). The chemical stability and the availability make this compound an excellent candidate for biochemical studies. D-(-)-3-Phosphoglyceric acid disodium has been shown to be essential in biological function, as it functions as a substrate for many metabolic pathways such as glycolysis, gluconeogenesis, pentose phosphate pathway, and fatty acid biosynthesis. The molecule is also involved in a number of biochemical reactions that are catalyzed by enzymes. Mutational studies have shown that organisms without this compound will not survive.</p>Formula:C3H5O7PNa2Purity:Min. 93%Color and Shape:White PowderMolecular weight:230.02 g/mol11-Keto fusidic acid
CAS:<p>Fusidic acid is a hydrophilic antibiotic that is structurally related to penicillin. It has a cavity that interacts with γ-cyclodextrin, which can be used for its monitoring and stoichiometry. Fusidic acid has hydroxyl groups that are located on the 7th and 8th positions of the fusidate ring. This antibiotic has been shown to have stability constants in a range of 10-10 M. Fusidic acid also has two electrophoretically distinct forms, depending on the pH of the solution. The form at pH 10 is called fusidane, while the form at pH 5 is called fusidate.</p>Formula:C31H46O6Purity:Min. 95%Molecular weight:514.69 g/molDecanoyl-Arg-Arg-Leu-Leu-chloromethylketone trifluoroacetate salt
CAS:<p>Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.</p>Formula:C35H67ClN10O5Purity:Min. 95%Molecular weight:743.42 g/molCromoglicic acid D5
CAS:<p>Please enquire for more information about Cromoglicic acid D5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6D5BrPurity:Min. 95%Color and Shape:PowderMolecular weight:473.40 g/mol2-[(2,3-Dimethylphenyl)amino]nicotinic acid
CAS:<p>2-[(2,3-Dimethylphenyl)amino]nicotinic acid is an arylpropionic acid that has been designed for the treatment of cancer. It is a neutral compound that can be crystallized or sterilized and then injected or implanted into tissues. The compound can be used as a diagnostic tool to target specific tissues in the body by using iontophoresis or organic solvents. 2-[(2,3-Dimethylphenyl)amino]nicotinic acid interacts with chlorine ions to form a chloride derivative, which is then transported through the tissue. This process can be reversed by adding an acid solution to the tissue, which will cause the chloride ions to break down into hydrogen and chloride ions.</p>Formula:C14H14N2O2Purity:Min. 95%Molecular weight:242.27 g/molDansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.</p>Formula:C28H32N6O9S·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:742.68 g/mol2,4-Dihydroxybenzenesulfonic acid
CAS:<p>2,4-Dihydroxybenzenesulfonic acid is a chemical compound that is used as a polymerization catalyst. It is most commonly used in the production of polyoxyethylene and copolymers. The catalytic activity of 2,4-dihydroxybenzenesulfonic acid is due to its acid group and hydroxy groups. This chemical can also be prepared by the reaction of resorcinol and hydrogen peroxide. The fluidity of this compound can be increased by adding an appropriate fluidizing agent such as peroxide or ammonium persulfate.</p>Formula:C6H6O5SPurity:Min. 95%Molecular weight:190.17 g/molLinolenic acid - 85%
CAS:<p>Linolenic acid is a polyunsaturated fatty acid that is found in plants, animals, and human cells. Linolenic acid has been shown to suppress the growth of cancer cells by inhibiting the production of linoleic acid, which can stimulate the growth of cancer cells. Linolenic acid has also been shown to cause skin reactions such as erythema and pruritus when applied topically or taken orally. Linolenic acid may be used for the treatment of ovarian follicles. In addition, linolenic acid has been shown to have an allergic response in humans when it is injected into the vein. It is important to note that linolenic acid can inhibit T-cell proliferation and cytokine production in a dose-dependent manner. Furthermore, linolenic acid inhibits lipopolysaccharide-induced acute lung injury in mice by reducing inflammatory cell infiltration and neutrophil activation.</p>Formula:C18H30O2Purity:Min. 95%Molecular weight:278.43 g/mol4-Acetamidobenzenesulfonic acid
CAS:<p>4-Acetamidobenzenesulfonic acid (4ABS) is an organic compound that is used as a sulfa drug. It is found in the filtrate of the chemical reaction between inulin and sulfamic acid. 4ABS acts as an amine catalyst for acyl transfer reactions. 4ABS also reacts with chloroethanol to form a primary amino group on a colloidal particle surface. This reaction has been shown to be reversible, where hydrochloric acid can react with 4ABS to form the corresponding sulfamic acid.</p>Formula:C8H9NO3SPurity:Min. 95%Molecular weight:199.23 g/molEthyl 4-formylpyrrole-2-carboxylate
CAS:<p>Ethyl 4-formylpyrrole-2-carboxylate is a chemical compound that is used as an intermediate in organic synthesis. The compound has been reported to have spectra at m/z (M+1) of 168, 156 and 140. It also has been reported to have yields of about 98% when synthesized from ethyl azidoacetate and ethyl bromoacetate. The mass spectra show the molecular ion peak at m/z of 168, 156 and 140 corresponding to the structure of ethyl 4-formylpyrrole-2-carboxylate. Furan, n-substituted furan, thiophene, acetamide and cyclization are other possible structures for this molecule.</p>Formula:C8H9NO3Purity:Min. 95%Molecular weight:167.16 g/mol3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester
CAS:<p>Please enquire for more information about 3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H47NO9Purity:Min. 95%Molecular weight:505.64 g/molC-Type Natriuretic Peptide (32-53) acetate salt
CAS:<p>C-type Natriuretic peptide is a peptide hormone that causes vasodilation, diuresis, and natriuresis. It is secreted by the heart and kidneys in response to volume overload. C-type Natriuretic peptide has been shown to cause fibrosis of the kidney as well as other tissues in mice. The binding of C-type Natriuretic peptide to its receptor activates cyclase, which converts ATP into cAMP. This leads to increased levels of cGMP, which causes smooth muscle relaxation and vasodilation.</p>Formula:C93H157N27O28S3Purity:Min. 95%Molecular weight:2,197.6 g/moltert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride
CAS:<p>Please enquire for more information about tert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N2O2Purity:Min. 95%Molecular weight:246.31 g/molSodium phenylacetate
CAS:Controlled Product<p>Sodium phenylacetate is a chemical compound that is used as an antifungal agent in vitro. It has also been shown to have anti-proliferative and cytotoxic effects on neuroblastoma cells. The physiological function of sodium phenylacetate is not well understood, but it may act as a neurotransmitter by inhibiting the release of acetylcholine or by regulating cell signaling pathways. Sodium phenylacetate may also inhibit angiogenesis, which would limit the growth of cancerous tumors.</p>Formula:C8H7NaO2Purity:Min. 95%Color and Shape:PowderMolecular weight:158.13 g/molN,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide
CAS:<p>N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide is a molecule that has an optimum concentration of 0.5 M. It has a hydrogen bond donor and acceptor and is optically active. This molecule displays fluorescence properties and is inorganic with a chloride acceptor group. N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide has been shown to have high photostability and to be enhanced by light emission from a diode. This molecule also has carbonyl groups that are electron donors for the fluorescence process.</p>Formula:C49H50N6O4Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:786.96 g/mol7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid
CAS:<p>7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid (ABT) is a drug that binds to bacterial enzymes and inhibits their ability to synthesize proteins. ABT is a conjugate of fluoroquinolone and an amino acid. As the drug is degradable by hydrolysis, it has been shown to be less toxic in Sprague Dawley rats than other fluoroquinolones. This drug has been used in diagnostic tests as a ligand for affinity ligands, but has not been approved for human use. The drug also possesses functional groups that are important for binding to reconstituted enzymes.br>br>ABT's ester linkages are degradable by hydrolysis and can be</p>Formula:C20H16F3N3O3Purity:Min. 95%Molecular weight:403.35 g/mol5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid
CAS:<p>Please enquire for more information about 5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N5O3Purity:Min. 95%Color and Shape:White To Yellow To Dark Red SolidMolecular weight:301.3 g/molMethyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H9N3O4Purity:Min. 95%Molecular weight:271.23 g/molIsatin-5-sulfonic acid sodium salt dihydrate
CAS:<p>Isatin-5-sulfonic acid sodium salt dihydrate is a potent inhibitor of caspases. It has been shown to inhibit the activity of caspase-3 in vitro, thereby inhibiting apoptosis. Isatin-5-sulfonic acid sodium salt dihydrate has also been shown to increase survival rates in animal models of neurodegenerative diseases such as Parkinson's disease and Huntington's disease. Isatin-5-sulfonic acid sodium salt dihydrate may have neuroprotective effects by inhibiting the release of proinflammatory cytokines and nitric oxide, which are associated with neuronal death. This drug also inhibits monoamine oxidase A (MAO-A) and zymosterone B (ZVAD).</p>Formula:C8H4NNaO5S·2H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:285.21 g/molKermesic acid
CAS:<p>Kermesic acid is a hydroxybenzoic acid that is used as a food dye. It can be found in some red wines and it is also used to color the eggs of a particular breed of chicken. The most common use for kermesic acid is as an oxidizing agent in a chromatographic method, which separates molecules based on their size. The oxidation catalyst used can vary, but often trifluoroacetic acid (TFA) is used. TFA reacts with the kermesic acid to form an octaketide, which has the chemical formula C8H6O3. This octaketide then reacts with another molecule of TFA to form two esters.</p>Formula:C16H10O8Purity:Min. 95%Molecular weight:330.25 g/molDomoic acid
CAS:<p>Domoic acid is a neurotoxin that has been shown to induce neuronal death in vitro and in vivo. Domoic acid inhibits the activity of ligand-gated ion channels, which increases the cytosolic Ca2+ concentration. This toxin also induces mitochondrial membrane potential loss, causing apoptosis. Domoic acid binds to the NMDA receptor and blocks glutamate binding. It also inhibits ATP synthase by competing with ADP for binding sites on the enzyme's F1 portion. Domoic acid has low potency as a neurotoxin because it does not readily cross the blood-brain barrier or enter cells via passive diffusion.</p>Formula:C15H21NO6Purity:Min. 90 Area-%Color and Shape:Beige PowderMolecular weight:311.33 g/mol2-(4-Hydroxyphenyl)propionic Acid
CAS:Formula:C9H10O3Purity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow to Light red powder to crystalMolecular weight:166.183-(4-Carboxyphenyl)propionic Acid
CAS:Formula:C10H10O4Purity:>98.0%(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:194.193-Iodo-4-methoxybenzoic Acid
CAS:Formula:C8H7IO3Purity:>97.0%(GC)(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:278.0516-Hydroxyhexadecanoic Acid
CAS:Formula:C16H32O3Purity:>98.0%(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:272.433,4-Dihydroxyhydrocinnamic Acid
CAS:Formula:C9H10O4Purity:>98.0%(GC)(T)Color and Shape:White to Brown powder to crystalMolecular weight:182.183,3-Dimethyl-2-oxobutyric Acid
CAS:Formula:C6H10O3Purity:>98.0%(T)Color and Shape:White or Colorless to Almost white or Almost colorless powder to lump to clear liquidMolecular weight:130.14tert-Butyl Hydrogen Tetradecanedioate
CAS:Formula:C18H34O4Purity:>95.0%(GC)(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:314.47(Ethylenedithio)diacetic Acid
CAS:Formula:C6H10O4S2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:210.26cis-4-(tert-Butoxycarbonylamino)cyclohexanecarboxylic Acid
CAS:Formula:C12H21NO4Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:243.304-Bromo-2-methylbenzoic Acid
CAS:Formula:C8H7BrO2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:215.052-Chlorobutyric Acid
CAS:Formula:C4H7ClO2Purity:>90.0%(GC)Color and Shape:Colorless to Light orange to Yellow clear liquidMolecular weight:122.55Strontium oxalate, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C2O4SrPurity:95%Color and Shape:White, Powder or lumpMolecular weight:175.64Ethyl cyanoformate, 99%
CAS:<p>Ethyl cyanoformate is used as reagent in the preparation of N-substituted amindinoformic acid and ethyl-4-quinazoline -2-carboxylate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the leg</p>Formula:C4H5NO2Purity:99%Color and Shape:Clear or slightly turbid colorless, LiquidMolecular weight:99.09Isopropyl palmitate, tech. 85%
CAS:<p>Isopropyl palmitate is used to formulate and evaluate the suitability of pluronic lecithin organogels containing flurbiprofen for topical application and to characterize microemulsion systems of isopropyl palmitate, water and 2:1 Brij 97, and 1-butanol by different experimental techniques. This Ther</p>Formula:CH3(CH2)14CO2CH(CH3)2Purity:85%Color and Shape:Liquid, Clear colorlessMolecular weight:298.51Methyl 1-methylpyrrole-2-carboxylate, 99%
CAS:<p>Methyl 1-methylpyrrole-2-carboxylate is used as chemical and organic Intermediates. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item c</p>Formula:C7H9NO2Purity:99%Color and Shape:Clear colorless to yellow to orange, LiquidMolecular weight:139.15Methyl 3-methoxythiophene-2-carboxylate, 97%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C7H8O3SPurity:97%Color and Shape:White to pale brown, Crystals or powder or crystalline powderMolecular weight:172.20N-(4-Bromobutyl)phthalimide, 96%
CAS:<p>N-(4-Bromobutyl)phthalimide is used in organic synthesis and the production of pharmaceutical. It can react with 1-phenyl-piperazine to get N-[4-(4-phenyl-piperazin-1-yl)-butyl]-phthalimide. It is a useful synthesis reagent used to synthesize B-cyclodextrin derivatives. This Thermo Scientific Chemic</p>Formula:C12H12BrNO2Purity:96%Color and Shape:White to cream, PowderMolecular weight:282.14Sodium DL-lactate, 60% w/w aq. soln.
CAS:<p>Useful chiral synthon; building block for depsipeptides</p>Formula:C3H5NaO3Purity:60%Molecular weight:112.06o-Cresolphthalein complexone, indicator grade
CAS:<p>Indicator for complexometric titration of Mg, Ca, Sr and Ba. It is used as an alkaline earth metal ion indicator. Suggested to be colorless at pH 11, but turns pink in the presence of alkaline earth metals. Also utilized in an auto analyzer to determine serum calcium. This Thermo Scientific Chemical</p>Formula:C32H32N2O12Color and Shape:White to cream, PowderMolecular weight:636.612-Phenylethyl acetate, 98%
CAS:<p>Phenylethyl acetate mantains the typical rose notes of Phenylethanol with a more intense honey profile which is perfect for fruit and alcoholic drink applications. It is used as a pharmaceutical intermediate and also it holds application in gas chromatography and liquid chromatography. This Thermo S</p>Formula:C10H12O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:164.20Adipic dihydrazide, 97%
CAS:<p>Adipic dihydrazide is used as a formaldehyde scavenger and reacts with formaldehyde, thereby preventing the volatilizing of formaldehyde in the air. It is also employed as a paint additive and coating additive. It is also used as an intermediate. Further, it is used for cross-linking water-based emu</p>Formula:C6H14N4O2Purity:97%Color and Shape:White to pale cream or pale yellow, Powder or crystalline powderMolecular weight:174.205-Hexenyl acetate, 97%
CAS:<p>(4E,7Z)-4,7-Tridecadienyl acetate,a component of the sex pheromone was synthesized from 5-hexenyl acetate. CM of 5-decene with 5-hexenyl acetate is used to produce the insect pheromone. Used in olefin cross metathesis. This Thermo Scientific Chemicals brand product was originally part of the Alfa Ae</p>Formula:C8H14O2Purity:97%Color and Shape:LiquidMolecular weight:142.21-Naphthylacetic acid, 95%, may cont. up to 5% 2-isomer
CAS:<p>1-Naphthylacetic acid is used as a plant growth regulator and for plant tissue culture. It is used for the vegetative propagation of plants from stem and leaf cutting, abscission promoter and substrate for auxin inducers of specific plant enzymes. Further, it stimulates root formation in cuttings of</p>Formula:C12H10O2Purity:95%Color and Shape:White to cream to yellow or pale brown, Crystalline powder or powderMolecular weight:186.21tert-Butyl cyanoacetate, 98%
CAS:<p>tert-Butyl cyanoacetate is used in the synthesis of vinylogous urea. It is also used as a new additive for the sugar nucleoside base coupling step en route to DAPD with improved -selectivity. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some</p>Formula:NCCH2CO2C(CH3)3Purity:98%Color and Shape:Liquid or viscous liquid, Clear colorless to white to yellowMolecular weight:141.17Methyl cyclopentanecarboxylate, 97%
CAS:<p>Methyl cyclopentanecarboxylate This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the</p>Formula:C7H12O2Purity:97%Color and Shape:Clear colorless to pale yellow, LiquidMolecular weight:128.17Methyl chlorodifluoroacetate, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C3H3ClF2O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:144.50N-(2-Hydroxyethyl)succinimide, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H9NO3Purity:95%Color and Shape:White to cream to pale yellow, Crystals or powder or crystalline powder or lumps or fused solidMolecular weight:143.143-Acetoxy-2-butanone, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H10O3Purity:98%Color and Shape:Liquid, Clear colorless to pale yellowMolecular weight:130.144-(Methoxycarbonyl)cyclohexane-1-carboxylic acid, 97%
CAS:<p>4-(Methoxycarbonyl)cyclohexane-1-carboxylic acid is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / i</p>Formula:C9H14O4Purity:97%Molecular weight:186.21Hydantoin-5-acetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C5H6N2O4Purity:98%Color and Shape:Crystalline powder, WhiteMolecular weight:158.11Cycloheptylacetic acid, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H16O2Purity:99%Color and Shape:Clear colorless, LiquidMolecular weight:156.23Dehydroacetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C8H8O4Purity:98%Color and Shape:Powder, White to cream or pale yellowMolecular weight:168.15Ethyl tert-butylacetate, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C8H16O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:144.21n-Butylidenephthalide, (E)+(Z), 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C12H12O2Purity:95%Color and Shape:Clear, yellow, LiquidMolecular weight:188.23N-(4-Pentynyl)phthalimide, 97%
CAS:<p>N-(4-Pentynyl)phthalimide is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU referen</p>Formula:C13H11NO2Purity:97%Color and Shape:White to yellow to pale brown, PowderMolecular weight:213.243-(3-Fluorophenyl)propionic acid, 97%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H9FO2Purity:97%Color and Shape:White to cream or pale yellow, Crystals or powder or crystalline powderMolecular weight:168.17Dimethyl fumarate, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H8O4Purity:99%Color and Shape:Crystals or crystalline powder or flakes, White to cream to pale brownMolecular weight:144.13


