Carboxylic Acids

<p>Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-Cys-Glu-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>

<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 3-chlorophenylacetate is a chemical intermediate that has been used in the synthesis of pharmaceuticals and organic compounds. It has also been used as a reagent for research, especially in the study of organic chemistry. Methyl 3-chlorophenylacetate is a versatile building block and can be used as a reaction component to synthesize other chemicals. This compound is also an excellent scaffold for medicinal chemistry.</p>

<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>

<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>

<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>

<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>

<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>

<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>

<p>Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxy-4-(methylthio)butyric acid calcium salt (2HMBAC) is a fatty acid that is found in malic acid. It is an important industrial chemical used for the preparation of other chemicals such as acetic anhydride, adipic acid, and butyric acid. 2HMBAC has been shown to have various biological functions including the inhibition of protein synthesis and the reduction of chloride ion transport. The dietary administration of 2HMBAC has been shown to relieve diarrhoea in rats.</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Pro-Arg-Pro-NH2 acetate salt is a peptide with antiplatelet activity. It has been shown to inhibit the interaction between fibrinogen and platelets, which leads to the inhibition of thrombin formation and subsequent clotting. The amide bond in this peptide is susceptible to hydrolysis by enzymes such as phospholipase A2, which means that it can be broken down into smaller fragments that have different biological activities. H-Gly-Pro-Arg-Pro-NH2 acetate salt has been shown to inhibit the growth of babesia microti, a causative agent of babesiosis in cattle, through lysis of infected erythrocytes. This drug also inhibits the growth of hemagglutinating virus type 3 (HV3) and filovirus, two viruses that are not yet fully understood.</p>

<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>

<p>(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester is an acidic substance that can be produced by the amination of piperazine with chloroacetic acid. The reaction solution is heated to a temperature of about 120°C for about 30 minutes and then cooled to room temperature. The product precipitates as a white solid. This compound has been shown to have antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA) in plates.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(Bromomethyl)phenylacetic acid is a potent cancer drug that blocks the activity of hydrogen-bonding interactions. It inhibits the growth of prostate cancer cells, DU145 cells, and other cell lines. The drug has been shown to inhibit the activation of toll-like receptor 4 (TLR4) in primary blood cells from healthy donors. TLR4 is a protein found on the surface of immune cells that senses molecules from bacteria, fungi, parasites, and viruses. This protein plays an important role in triggering anti-inflammatory and pro-inflammatory responses to infection. The drug also inhibits platelet aggregation and lipoprotein lipase activity in vitro.</p>

<p>H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.</p>

<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>

<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>

<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1H-Pyrrole-2,5-dicarboxylic acid is a biosynthetic precursor of the amide functional group. It is synthesized from the carboxylic acid functional group and ferrocene. It has been shown to be a putative precursor of pyrrole-2-carboxylic acid in the pyrrole system. 1H-Pyrrole-2,5-dicarboxylic acid reacts with carbon tetrachloride and diethyl iminodiacetate in refluxing chloroform to produce coelicolor. The reaction mechanism for this transformation is unknown, but it is hypothesized that it involves a radical mechanism.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>

<p>Please enquire for more information about 3-Acetylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>

<p>Ganoderic acid G is a natural compound that has been extracted from the mushroom Ganoderma lucidum. It has been shown to have anticancer, anti-inflammatory, immunomodulatory, and antioxidant properties. Ganoderic acid G inhibits cancer cell proliferation by inhibiting fatty acid synthesis and promoting apoptosis in cancer cells. It also inhibits the production of inflammatory cytokines such as tumor necrosis factor-α (TNF-α). Ganoderic acid G has been found to inhibit the production of reactive oxygen species in human liver cells.</p>

<p>Rhodanine-N-acetic acid is a model system for antimicrobial agents. It is an acidic molecule with low light absorption and can be used as a chemotherapeutic agent. Rhodanine-N-acetic acid has been shown to have high resistance to bacteria in vitro, making it effective against malonic acid, which is the main cause of infection. Rhodanine-N-acetic acid has been shown to have biological properties, such as photophysical and redox potentials that make it suitable for use in vivo. Rhodanine-N-acetic acid also has photocurrent and electrochemical impedance spectroscopy characteristics that may be used to measure its activity in vivo.</p>

<p>Please enquire for more information about Abz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>