Primary Antibodies

<p>Rabbit Polyclonal AFX antibody (Ser197)</p>

<p>The Podocin antibody is a cytotoxic monoclonal antibody used in Life Sciences. It is specifically designed to target VEGF (vascular endothelial growth factor) and inhibit its activity. This antibody has been extensively studied for its glycosylation patterns and its interaction with other growth factors, such as epidermal growth factor. The Podocin antibody has shown promising results in inhibiting the activity of arginase, an enzyme involved in the metabolism of arginine. It can be used in various research applications, including electrophoresis and immunohistochemistry. With its high specificity and affinity, this monoclonal antibody offers a valuable tool for researchers working in the field of growth factors and angiogenesis.</p>

<p>HYLS1 antibody was raised in Rabbit using Human HYLS1 as the immunogen</p>

<p>Rabbit polyclonal PKC theta antibody</p>

<p>Affinity purified Rabbit polyclonal MAPK3 antibody</p>

<p>Purified Polyclonal SLC43A1 antibody</p>

<p>ARSB antibody was raised in Rabbit using Human ARSB as the immunogen</p>

<p>Purified Rabbit polyclonal GAPDH-Chl antibody</p>

<p>AGPAT9 antibody was raised in Rabbit using Human AGPAT9 as the immunogen</p>

<p>TRAF1 antibody was raised in rabbit using the middle region of TRAF1 as the immunogen</p>

<p>Rabbit Polyclonal Keratin 18 antibody (Ser33)</p>

<p>The TGFBR3 antibody is a valuable tool in the field of Life Sciences. It specifically targets the monophosphate growth factor receptor, TGFBR3, and can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry. This antibody recognizes annexin A2, a marker peptide that plays a crucial role in cell signaling pathways. With its high specificity and sensitivity, the TGFBR3 antibody is an essential diagnostic reagent for researchers studying cellular processes related to nucleotide-binding domains and polymerase chain reactions. Additionally, this antibody has shown neuroprotective properties and may have potential as a therapeutic medicament. Its ability to form molecular weight complexes with adenosine receptor antagonists suggests its involvement in chloride transport regulation. The TGFBR3 antibody is a versatile tool that holds great promise for advancing scientific research in various fields.</p>

<p>Rabbit polyclonal TNPO2 antibody</p>

<p>HLA DP DQ DR Monoclonal Antibody</p>

<p>EFNA4 antibody was raised in rabbit using the N terminal of EFNA4 as the immunogen</p>

<p>ALY/Ref Monoclonal Antibody (FITC)</p>

<p>SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV</p>

<p>Purified Polyclonal DIAPH2 antibody</p>

<p>Rabbit polyclonal cKit antibody (Tyr721)</p>

<p>Purified Polyclonal Claudin 11 antibody</p>

<p>Mouse monoclonal Hemopexin antibody (Biotin)</p>

<p>Affinity purified Rabbit polyclonal Unc182 antibody</p>

<p>The ATF2 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to ATF2, a protein involved in various cellular processes such as gene regulation and DNA repair. The antibody has been extensively tested for its high specificity and sensitivity in detecting ATF2 in different experimental settings.</p>

<p>NEFH antibody was raised in Rabbit using Human NEFH as the immunogen</p>

<p>Cytokeratin 6 antibody was raised in mouse using cytokeratin 6 of human callus cytoskeletal preparation as the immunogen.</p>

<p>Mouse monoclonal CD99 antibody (PE)</p>

<p>Pseudomonas aeruginosa serotype 16c Monoclonal Antibody</p>

<p>CA8 antibody was raised in Rabbit using Human CA8 as the immunogen</p>

<p>Rb antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the tnf-α antigen and has been shown to inhibit endothelial growth. This antibody binds to tyrosine residues on the target protein, mimicking the action of growth factor antibodies. In addition to its role in angiogenesis, Rb antibody can also be used in nuclear studies to detect and quantify specific proteins using techniques such as polymerase chain reaction (PCR). Polyclonal Antibodies are also available for this target, providing researchers with a range of options for their experiments.</p>

<p>Rabbit polyclonal THNSL2 antibody</p>

<p>The TOP2A antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and inhibit the activity of TOP2A, an enzyme involved in DNA replication and repair processes. This antibody has been extensively studied and proven to effectively block the action of TOP2A, making it a valuable tool for researchers studying various biological pathways.</p>

<p>EGR1 antibody was raised in Mouse using a purified recombinant fragment of human EGR1(aa282-433) expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal SHPRH antibody</p>

<p>The TBP antibody is a highly specialized product used in Life Sciences research. It is an acidic polyclonal antibody that specifically targets the TATA-binding protein (TBP). This antibody is commonly used in various assays and techniques such as hybridization, ELISA, and immunoblotting.</p>

<p>DENND2C antibody was raised using the middle region of DENND2C corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL</p>

<p>MPPED2 antibody was raised in Rabbit using Human MPPED2 as the immunogen</p>

<p>CTBP2 antibody was raised in Rabbit using Human CTBP2 as the immunogen</p>

<p>Rabbit polyclonal APT1 antibody</p>

<p>The CHP antibody is a highly specialized antibody that belongs to the group of polyclonal and monoclonal antibodies. It is designed to target glycopeptides and has neutralizing properties. This antibody can be used in various applications within the field of Life Sciences, including research and diagnostics. The CHP antibody specifically binds to levothyroxine, a hormone involved in regulating metabolism, as well as other glycan molecules. It also has the ability to interact with interleukin-6, a protein associated with inflammation and immune response. Additionally, this antibody can be used for the detection and quantification of plasmids and TNF-α, a pro-inflammatory cytokine. The CHP antibody offers high specificity and sensitivity, making it an essential tool for researchers in various fields.</p>

<p>CACNG5 antibody was raised in Rabbit using Human CACNG5 as the immunogen</p>

<p>Protein S antibody (HRP) was raised in sheep using human Protein S purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal DARP32 antibody (Thr75)</p>

<p>Rabbit polyclonal AFG3L2 antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The GLB1 antibody is a trifunctional antibody that is used in bioassays and research in the field of Life Sciences. It has been shown to be effective in neutralizing the activity of human serum, particularly against chemokines. The GLB1 antibody also targets tyrosine kinase receptors and has been used in studies involving alpha-fetoprotein and anti-beta amyloid antibodies. Additionally, this antibody has been found to have genotoxic effects and can inhibit the activity of 3-kinase enzymes. Its versatility and specificity make it a valuable tool for researchers in various fields.</p>

<p>Rat monoclonal CD18 antibody (biotin)</p>

<p>NEDD4 antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT</p>

<p>EFNB1 antibody was raised in Rabbit using Human EFNB1 as the immunogen</p>

<p>CYP27A1 antibody was raised using the middle region of CYP27A1 corresponding to a region with amino acids SRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRI</p>

<p>The JAK1 antibody is a highly effective growth factor that has been extensively studied and proven to have numerous beneficial effects. This low-molecular-weight antibody is capable of activating transferrin, which plays a crucial role in the transport of iron throughout the body. Additionally, it has shown promising results in combating multidrug resistance and reducing the formation of amyloid plaque.</p>

<p>Purified Rabbit polyclonal GRB10 antibody (Tyr67)</p>

<p>CYTH2 antibody was raised in Rabbit using Human CYTH2 as the immunogen</p>

<p>SLC35F2 antibody was raised using the N terminal of SLC35F2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS</p>

<p>TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI</p>

<p>Rabbit polyclonal Kininogen 1 antibody (FITC)</p>

<p>Rabbit polyclonal PKIG antibody</p>

<p>The ZDHHC9 antibody is a highly specialized inhibitor that targets α-syn, an important protein involved in the development and progression of neurodegenerative diseases like Parkinson's. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the aggregation of α-syn and promoting its clearance from cells.</p>

<p>The CD200R antibody is a highly specialized antibody that is used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been specifically designed to target CD200R, which is a cell surface receptor involved in immune regulation. This antibody can be used for various applications, including the detection and quantification of CD200R expression in different tissues or cell types.</p>

<p>Rabbit polyclonal RXRG antibody</p>

<p>RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS</p>

<p>Rabbit polyclonal CCL22 antibody (biotin)</p>

<p>CD19 antibody was raised in Mouse using a purified recombinant fragment of human CD19 expressed in E. coli as the immunogen.</p>

<p>CTR9 antibody was raised in Rabbit using Human CTR9 as the immunogen</p>

<p>ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL</p>

<p>The TAU antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies. This antibody specifically targets actin, a protein involved in various cellular processes. It is commonly used in research studies to investigate actin filaments and their role in cell structure and function.</p>

<p>Affinity purified Rabbit polyclonal Liprin alpha 1 antibody</p>

<p>The S100B antibody is a highly specific and potent tool used in Life Sciences research. It is commonly used in gel chromatography and cytokine assays to detect and quantify S100B, a calcium-binding protein that acts as a chemokine and messenger RNA regulator. This antibody is available in both polyclonal and monoclonal forms, derived from plasma or serum, respectively. It has been extensively tested for its efficacy in primary microglial cultures and has shown excellent performance in detecting interleukins and other cytokines. Additionally, the S100B antibody can be used to study the role of c-x-c chemokine receptors in various biological processes. With its high specificity and sensitivity, this antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>The Cystatin C antibody is a highly specialized monoclonal antibody that targets MERTK, a receptor tyrosine kinase involved in cell growth and survival. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been used to detect and quantify Cystatin C levels in human serum, making it a valuable tool for diagnostic purposes. Additionally, this antibody has been used in research studies to investigate the role of MERTK in different cellular processes such as phagocytosis and immune response. Its high specificity and sensitivity make it an ideal choice for scientists looking to explore the functions of MERTK or develop new therapeutic strategies targeting this pathway.</p>

<p>WDR54 antibody was raised in rabbit using the C terminal of WDR54 as the immunogen</p>

<p>Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY</p>

<p>The MSI1 antibody is a highly reactive monoclonal antibody that is commonly used in Life Sciences research. It is specifically designed to neutralize the activity of the MSI1 protein, which plays a crucial role in various cellular processes. This antibody can be used in immunosuppression studies or as a tool to investigate the function of MSI1 in different biological systems.</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>ACTR3 antibody was raised in Rabbit using Human ACTR3 as the immunogen</p>

<p>The TGF alpha antibody is a growth factor that plays a crucial role in collagen synthesis and mitogen-activated protein signaling pathways. It promotes the growth of new blood vessels (microvessel density) and stimulates the production of proteins involved in endothelial cell growth. This antibody specifically targets TGF-beta and interleukin, which are key regulators of cell proliferation and differentiation.</p>

<p>ApoE antibody was raised in mouse using human apolipoprotein E as the immunogen.</p>

<p>The SERCA1 antibody is an active agent that is commonly used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to SERCA1, a low-density protein found in various cells including MCF-7 cells. This antibody is often used in research studies to investigate the role of SERCA1 in different cellular processes.</p>

<p>CD46 antibody was raised in Rabbit using Human CD46 as the immunogen</p>

<p>Mouse monoclonal AK5 antibody</p>

<p>Rabbit Polyclonal PKC mu antibody (Ser738)</p>

<p>The Histone H3 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to Histone H3, a protein involved in DNA packaging and gene regulation. This antibody has been extensively validated for its high specificity and sensitivity in detecting Histone H3 modifications, such as acetylation.</p>

<p>C7ORF29 antibody was raised using the middle region of C7Orf29 corresponding to a region with amino acids VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH</p>

<p>Affinity purified Mouse polyclonal Connexin 32 antibody</p>

<p>Mouse monoclonal LSM1 antibody</p>

<p>Rabbit polyclonal CTAK1 antibody</p>

<p>ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT</p>

<p>Rabbit polyclonal UGDH antibody</p>

<p>Rabbit polyclonal RANK antibody (HRP)</p>

<p>The GFRA4 antibody is an affinity ligand that specifically targets interleukin receptors. It has been isolated from retinal tissue and can be used as a test compound in various research studies. This antibody shows potential for the development of new medicines, particularly in the field of nuclear medicine and anti-thrombotic therapies. The GFRA4 antibody is part of a group of antibodies known as polyclonal antibodies, which are widely used as inhibitors or intermediates in various biomedical applications. Additionally, it has shown promise in the detection and treatment of autoantibodies and can be utilized in adeno-associated virus-based therapies. With its versatility and specificity, the GFRA4 antibody holds great potential for advancing scientific research and medical advancements.</p>

<p>RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL</p>

<p>ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL</p>

<p>MEMO1 antibody was raised in Rabbit using Human MEMO1 as the immunogen</p>

<p>The CD9 antibody is a highly activated monoclonal antibody that is used in the field of Life Sciences. It is produced by a hybridoma cell line and has been specifically designed to target the CD9 protein. This antibody has a high affinity for CD9, allowing it to bind to and neutralize its proteolytic activity.</p>

<p>Rabbit polyclonal OLIG1 antibody</p>

<p>Mouse monoclonal ADI1 antibody</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>The alpha Actinin antibody is a histidine-rich monoclonal antibody that specifically targets autoantibodies. It is commonly used in research and diagnostic applications to detect the presence of specific autoantibodies in biological samples. This antibody has high specificity and sensitivity, making it an ideal tool for studying autoimmune diseases and other related disorders.</p>

<p>Rabbit polyclonal JunD antibody (Ser255)</p>

<p>Mouse monoclonal SPR antibody</p>

<p>Purified Polyclonal CDC40 antibody</p>

<p>DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANS</p>