Primary Antibodies

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal p62 DOK antibody (Tyr398)</p>

<p>Rabbit polyclonal Cyclin E1 antibody; PBS buffer without Mg2+ and Ca2+</p>

<p>Morphine antibody was raised in mouse using Morphine-3-BSA as the immunogen.</p>

<p>C4 antibody was raised in Mouse using purified C4 from human blood as the immunogen.</p>

<p>TLK1 antibody was raised using the middle region of TLK1 corresponding to a region with amino acids RQIDEQQKLLEKYKERLNKCISMSKKLLIEKSTQEKLSSREKSMQDRLRL</p>

<p>Armenian Hamster monoclonal CD103 antibody (FITC)</p>

<p>COL25A1 antibody was raised in Rabbit using Human COL25A1 as the immunogen</p>

<p>Rabbit polyclonal MINPP1 antibody</p>

<p>Influenza A antibody (H1N1) (FITC) was raised in goat using Influenza A, strain USSR (H1N1) as the immunogen.</p>

<p>WNT2B antibody was raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT</p>

<p>Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser118)</p>

<p>Mouse monoclonal PRKAR2A antibody</p>

<p>NELF antibody was raised using the N terminal of NELF corresponding to a region with amino acids GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA</p>

<p>The SNAP25 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the SNAP25 protein, which plays a crucial role in dopamine release and neurotransmitter signaling. This antibody has been extensively validated for its specificity and sensitivity in detecting SNAP25 in various experimental settings.</p>

<p>The PLK1 antibody is a highly specific monoclonal antibody that targets the PLK1 protein. PLK1, also known as polo-like kinase 1, is a key regulator of cell division and plays a crucial role in maintaining genomic stability. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>HDL antibody was raised in mouse using purified human HDL as the immunogen.</p>

<p>Rabbit polyclonal PCDH1 antibody</p>

<p>Mouse monoclonal OXSR1 antibody</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>Rabbit polyclonal AHSA1 antibody (biotin)</p>

<p>Rabbit polyclonal GADD45GIP1 antibody</p>

<p>Rabbit polyclonal LMTK3 antibody</p>

<p>Purified Rabbit polyclonal IRF3 antibody (Ser396)</p>

<p>The CD43 antibody is a highly specific monoclonal antibody that is used in various applications in the field of life sciences. This antibody specifically targets CD43, a cell surface glycoprotein that is expressed on adipose tissue, liver microsomes, and other cell types. CD43 plays a crucial role in cell adhesion and signaling processes.</p>

<p>ANCA antibody was raised in mouse using extract from neutrophil azurophilic granules as the immunogen.</p>

<p>PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR</p>

<p>Mouse monoclonal CD11b antibody (biotin)</p>

<p>Affinity purified Rabbit polyclonal PDE4C antibody</p>

<p>ELK4 antibody was raised in Rabbit using Human ELK4 as the immunogen</p>

<p>RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE</p>

<p>The SLC12A5 antibody is a monoclonal antibody that targets the growth factor receptor HER2. It specifically binds to the carbonyl group on HER2, inhibiting its signaling pathway and preventing cell proliferation. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the growth of cancer cells that overexpress HER2. Additionally, the SLC12A5 antibody can be used for immobilization on electrodes to study protein-protein interactions or actin filament dynamics. Its high specificity and affinity make it a valuable tool for researchers studying various biological processes. Furthermore, this antibody has cytotoxic activity against cells expressing the antigen CD33, making it a potential therapeutic option for certain types of cancer.</p>

<p>Rabbit polyclonal NBS1 antibody (Ser343)</p>

<p>Mouse monoclonal CDK7 antibody</p>

<p>The Influenza B antibody is a monoclonal antibody that specifically targets the Influenza B virus. This antibody has been extensively studied and shown to have a high affinity for the virus, making it an effective tool for diagnostic assays and research purposes. It can be used in various applications, including the detection of Influenza B virus in patient samples, the quantification of viral load, and the characterization of viral strains. Additionally, this antibody has been used in studies investigating autoantibodies and their role in disease pathogenesis. Its specificity ensures accurate and reliable results, making it an essential component in the field of Life Sciences. With its exceptional binding properties and compatibility with different assay formats, this Influenza B antibody is a valuable tool for researchers working on understanding and combating influenza infections.</p>

<p>Rabbit polyclonal NUP107 antibody</p>

<p>Purified polyclonal DRG1 antibody (C-Terminal region)</p>

<p>Mouse monoclonal C3a desArg antibody (Biotin)</p>

<p>ELL antibody was raised in Rabbit using Human ELL as the immunogen</p>

<p>CD4 antibody (biotin) was raised in mouse using human CD4 as the immunoge.</p>

<p>FKHR antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the FKHR protein, which plays a crucial role in various cellular processes. This antibody is commonly used in studies related to tgf-beta1 signaling, ketamine-induced neurotoxicity, erythropoietin receptor expression, and erythropoietin signaling pathways. The FKHR antibody has been validated for use in multiple applications, including Western blotting, immunohistochemistry, and immunofluorescence. It is derived from human serum and has been purified and buffered for optimal performance. This high-quality antibody offers reliable and consistent results, making it an essential tool for researchers studying FKHR and its associated pathways.</p>

<p>Purified Rabbit polyclonal SLC16A2 antibody</p>

<p>PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN</p>

<p>MGAT1 antibody was raised in Rabbit using Human MGAT1 as the immunogen</p>

<p>The RLBP1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize RLBP1, a protein involved in various cellular processes. This antibody is commonly used in research and diagnostic applications, particularly in the detection and quantification of RLBP1 in human serum samples.</p>

<p>The SUOX antibody is a monoclonal antibody used in the field of Life Sciences. It is designed to target and activate specific proteins involved in various biological processes. This antibody has shown promising results in the activation of fibrinogen, lipoprotein lipase, epidermal growth factor, and phosphatase. Additionally, it has been observed to have an effect on collagen and annexin. The SUOX antibody can be utilized as a medicament for therapeutic purposes, potentially offering new treatment options in the medical field.</p>

<p>Rabbit polyclonal TPM3 antibody</p>

<p>Affinity purified Rabbit polyclonal RPL13A antibody</p>

<p>Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of Estrogen Receptor(aa130-339) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal TAS2R7 antibody</p>