
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,461 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38244 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Thrombin Receptor Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Thrombin Receptor Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H91N17O20S2Purity:Min. 95%Molecular weight:1,410.58 g/molAcetyl-Neurotensin (8-13) Ac-Arg-Arg-Pro-Tyr-Ile-Leu-OH
CAS:<p>Acetyl-neurotensin (8-13) Ac-Arg-Arg-Pro-Tyr-Ile-Leu-OH is a competitive antagonist of the NANC neurotransmitter, neuropeptide Y. It is a proteolytic product of neurotensin, an endogenous peptide that has been implicated in a number of physiological and pathological processes. Acetyl-neurotensin (8-13) Ac-Arg-Arg-Pro-Tyr-Ile-Leu-(OH) binds to the membrane receptors on neurons and blocks the binding of neuropeptides such as neurotensin and substance P to these receptors, thereby inhibiting their effects on the central nervous system. This compound is soluble in water and can be used for bladder protection by preventing the accumulation of urine.</p>Formula:C40H66N12O9Purity:Min. 95%Molecular weight:859.03 g/molHIV Protease Substrate III
CAS:<p>HIV protease is a large protein that cleaves the polyprotein of HIV. This enzyme is essential for viral replication and so any drug that inhibits its function will inhibit HIV infectivity. The HIV protease substrate III, which contains histidine at position 3, has been used to study the effects of HIV proteases on different tissue types. It has been shown that this substrate can be detected in the cytoplasm and vacuole of cells infected with HIV, indicating that it may be involved in the transport process. The addition of an acidic amino acid (p-nitro-phenylalanine) to the substrate increases its antiviral activity by increasing its stability against proteolytic enzymes and allowing it to penetrate into cells more easily.</p>Formula:C58H95N19O16Purity:Min. 95%Molecular weight:1,314.49 g/molH-Trp-Gly-Gly-Tyr-OH
CAS:<p>Please enquire for more information about H-Trp-Gly-Gly-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N5O6Purity:Min. 95%Molecular weight:481.5 g/molZ-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O5·C2H4O2Purity:Min. 95%Molecular weight:679.77 g/molH-D-Leu-pNA
CAS:<p>Please enquire for more information about H-D-Leu-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N3O3Purity:Min. 95%Molecular weight:251.28 g/molHIV-1 rev Protein (34-50)
CAS:<p>Please enquire for more information about HIV-1 rev Protein (34-50) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H173N51O24Purity:Min. 95%Molecular weight:2,437.74 g/molH-Met-Lys-OH formiate salt
CAS:<p>H-Met-Lys-OH formiate salt is an industrial chemical that can be used in the preparation of pharmaceutical preparations. It has been shown to have a potential to lower blood pressure and reduce the risk of cardiovascular diseases. H-Met-Lys-OH formiate salt is a lysine derivative that contains two amino acid residues, namely lysine and methionine. H-Met-Lys-OH formiate salt can be used as a therapeutic agent for prostate cancer by targeting tp53 mutations and radical prostatectomy. It can also be used as an antibacterial agent against gram-negative bacteria, such as Escherichia coli (E. coli).</p>Formula:C11H23N3O3SPurity:Min. 95%Molecular weight:277.38 g/molH-Thr(tBu)-NH2·HCl
CAS:<p>Please enquire for more information about H-Thr(tBu)-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H18N2O2·HClPurity:Min. 95%Molecular weight:210.7 g/molSuc-Ala-Ala-Phe-pNA
CAS:<p>Suc-Ala-Ala-Phe-pNA is a peptide that is being studied for its potential to act as an anticancer agent. It inhibits the growth of tumor cells by binding to the neurokinin receptor and thereby blocking the production of substances such as epidermal growth factor, which promote tumor growth. Suc-Ala-Ala-Phe-pNA also has been shown to inhibit the activity of enzymes involved in glucocorticoid receptors, which are proteins that play a key role in regulating the immune response. This peptide also has been shown to be active against mouse skin cells and human prostate cancer cells. In addition, it is believed that this peptide may be useful in gene therapy because it can induce apoptosis in tumor cells without affecting normal tissue.</p>Formula:C25H29N5O8Purity:Min. 95%Molecular weight:527.53 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/molH-Ala-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Ala-Pro-Ala-OH is a tetrapeptide that inhibits elastase, an enzyme that breaks down elastin. This compound has been shown to have anti-elastolytic activity in vitro and in vivo. H-Ala-Ala-Pro-Ala-OH was administered intraperitoneally to hamsters with induced emphysema, resulting in a decrease of elastin abnormalities and improvement of the ultrastructure of the lungs. It also improves pancreatic morphology and function in porcine pancreatitis models.</p>Formula:C14H24N4O5Purity:Min. 95%Molecular weight:328.36 g/molPhenylacetyl-(D-Arg2·28,p-chloro-Phe6, Homoarg 9·29,Tyr(Me)10, Abu 15, Nle 27)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about Phenylacetyl-(D-Arg2·28,p-chloro-Phe6, Homoarg 9·29,Tyr(Me)10, Abu 15, Nle 27)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C172H284ClN53O41Purity:Min. 95%Molecular weight:3,785.88 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H217N47O41S4Purity:Min. 95%Molecular weight:3,306.75 g/mol1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt)
CAS:<p>1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:(C2H4O)nC44H87N2O10P•H3NPurity:Min. 95%Color and Shape:White PowderSuc-Ala-Gln-Pro-Phe-pNA
CAS:<p>Suc-Ala-Gln-Pro-Phe-pNA is a peptide that is composed of 18 amino acids. This peptide has a molecular weight of 2,812. It has been shown to have biochemical activity in vitro and in vivo. Suc-Ala-Gln-Pro-Phe-pNA is an erythropoietin receptor agonist that has shown homologous sequences with tyrosine kinase receptors and collagen. This protein was expressed in the endoplasmic reticulum, cytosol, and mitochondria of cells. The enzyme phosphatase hydrolyzed the peptide during incubation with calf thymus DNA.</p>Formula:C32H39N7O10Purity:Min. 95%Molecular weight:681.69 g/molKentsin
CAS:<p>Kentsin H-Thr-Pro-Arg-Lys-OH is a synthetic peptide that is used as a conditioning agent in vitro and in vivo. It was initially developed as an anti-viral to combat HIV, but has been found to possess contraceptive properties. Kentsin H-Thr-Pro-Arg-Lys-OH inhibits the proliferation of human granulosa cells by blocking ovulation and interfering with the regular development of ovarian follicles. It has been shown to be effective against Pim1, a progesterone receptor on granulosa cells. The concentration response curve for Kentsin H-Thr-Pro-Arg Lys OH shows that it can inhibit ovulation at concentrations as low as 1 μM.</p>Formula:C21H40N8O6Purity:Min. 95%Molecular weight:500.59 g/molZ-Pro-D-Leu-D-Ala-NHOH
CAS:<p>Z-Pro-D-Leu-D-Ala-NHOH is a neutralizing peptide that inhibits the activity of elastase and collagenase. It also has potent inhibitory activities against experimental infection with various microorganisms, including Streptococcus pyogenes, Staphylococcus aureus, and Pseudomonas aeruginosa. This peptide is a molecule consisting of 11 amino acids, which is synthesized in vivo by the host as a response to bacterial infections. Z-Pro-D-Leu-D-Ala-NHOH can be used for pharmaceutical preparations or techniques that require an enzyme inhibitor. The biological function of this peptide is not fully understood but it has been shown to have antiestrogenic effects.</p>Formula:C22H32N4O6Purity:Min. 95%Molecular weight:448.51 g/molH-β-Ala-Leu-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18N2O3Purity:Min. 95%Molecular weight:202.25 g/molH-Met-Ser-OH
CAS:<p>H-Met-Ser-OH is a dihedral molecule that has an amino acid composition of H, Met, Ser, and OH. It is acidic and has efficiencies in polarizability and acceptor. The dipole moment of the molecule is hydrogen bonding interactions with sequences. The vibrational frequencies are computationally predicted by computational methods. The sulfate fractionation was used to determine the percent of H-Met-Ser-OH in human liver tissue.</p>Formula:C8H16N2O4SPurity:Min. 95%Molecular weight:236.29 g/mol4-Chloro-6-methyl-2-trifluoromethylpyrimidine
CAS:<p>Please enquire for more information about 4-Chloro-6-methyl-2-trifluoromethylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4ClF3N2Purity:Min. 95%Molecular weight:196.56 g/molH-Ala-Lys-Leu-Arg-Glu-Arg-Leu-Lys-Gln-Arg-Gln-Gln-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Ile-Leu-Phe-Leu-Gln-Glu-Gly-Gly-Leu-OH
CAS:<p>Please enquire for more information about H-Ala-Lys-Leu-Arg-Glu-Arg-Leu-Lys-Gln-Arg-Gln-Gln-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Ile-Leu-Phe-Leu-Gln-Glu-Gly-Gly-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H262N52O42Purity:Min. 95%Molecular weight:3,478.02 g/molZ-Ala-Gly-Gly-OH
CAS:<p>Z-Ala-Gly-Gly-OH is a hydrophobic amino acid that can be used in the treatment of cancers. It has been shown to interact with residues on lysine and aspartic acid, which may be due to its acidic properties. This compound is also able to bind metal ions such as copper and zinc, which may contribute to its anticancer potential. Z-Ala-Gly-Gly-OH also acts as a ligand for anticancer drugs such as carbonyl group or hydroxyl radicals.</p>Formula:C15H19N3O6Purity:Min. 95%Molecular weight:337.33 g/molN-(4-Methoxybenzylidene)-4-butylaniline
CAS:<p>N-(4-Methoxybenzylidene)-4-butylaniline is an organic compound that belongs to the group of liquid crystals. It has been used in the study of phase transitions and thermal properties. The melting point of N-(4-methoxybenzylidene)-4-butylaniline is between -80 and -90 °C, depending on the solvent. This compound has a low proton affinity, but it can be oxidized to form a radical cation.</p>Formula:C18H21NOPurity:Min. 95%Molecular weight:267.37 g/molACTH (34-39)
CAS:<p>Please enquire for more information about ACTH (34-39) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H50N6O9Purity:Min. 95%Molecular weight:722.83 g/molH-Ser-Tyr-betaNA
CAS:<p>Please enquire for more information about H-Ser-Tyr-betaNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23N3O4Purity:Min. 95%Molecular weight:393.44 g/molBz-D-Thr-OMe
CAS:<p>Bz-D-Thr-OMe is a synthetic peptide with an amino acid sequence of Bz-D-Thr-OH. It has the chemical formula C14H24N2O4S and a molecular weight of 288.4 g/mol. This peptide reacts selectively with the n-terminal amino and carboxylic acids in peptides, cleaving the peptide bonds between these residues to produce free amino acids.</p>Formula:C12H15NO4Purity:Min. 95%Molecular weight:237.25 g/molLeptin tifluoroacetic acid (150-167)
CAS:<p>Leptin tifluoroacetic acid (150-167) is a diagnostic agent that can be used to measure leptin in vivo. Leptin tifluoroacetic acid (150-167) is an agonist for the leptin receptor, which has been shown to have effects on locomotor activity, body weight and body mass index in animals. Leptin tifluoroacetic acid (150-167) has also been shown to have anti-inflammatory properties and may be of use in the treatment of bowel diseases such as inflammatory bowel disease or bowel disease. Leptin tifluoroacetic acid (150-167) binds with high affinity to human fat cells, allowing it to be used as a marker for fat cell differentiation and energy metabolism. The main function of leptin is regulation of food intake and energy expenditure by acting on receptors in the brain, liver, muscle and other tissues.</p>Formula:C87H138N22O28S2•(CF3CO2H)xPurity:Min. 95%Molecular weight:2,004.29 g/molBz-Ala-Arg-OH
CAS:<p>Bz-Ala-Arg-OH (BAR) is a peptidase that hydrolyzes peptide bonds in proteins. BAR has been shown to have an intravascular function, which means it is found in the blood and vascular endothelium. BAR has also been shown to be an effective agent for inhibiting the release of hydrogen peroxide (H2O2) induced by dimethylthiourea in isolated rat lungs. BAR was isolated from the rat hypothalamus and shows a high degree of similarity to other peptidases such as aminopeptidase N, carboxypeptidase A, and carboxypeptidase B. These enzymes are involved in the catabolism of hormones such as angiotensin II, adrenocorticotropic hormone, and vasopressin.</p>Formula:C16H23N5O4Purity:Min. 95%Molecular weight:349.39 g/molBz-Asn-Gly-Thr-NH2
CAS:<p>Please enquire for more information about Bz-Asn-Gly-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O6Purity:Min. 95%Molecular weight:393.39 g/molH-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H71N11O15S2Purity:Min. 95%Molecular weight:1,226.38 g/molS-(1,2-Dicarboxyethyl)glutathione
CAS:<p>S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.</p>Formula:C14H21N3O10SPurity:Min. 95%Molecular weight:423.4 g/molFA-Arg-Leu-OH
CAS:<p>Please enquire for more information about FA-Arg-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H29N5O5Purity:Min. 95%Molecular weight:407.46 g/molH-Gly-Gly-Met-OH
CAS:<p>H-Gly-Gly-Met-OH is a hydrophobic amino acid with a decelerated reaction. It has been shown to modulate the growth of organisms, such as Staphylococcus aureus and Streptococcus pneumoniae. This molecule also has aspirin-like activity against S. aureus and can be used for cavity prevention. H-Gly-Gly-Met-OH is effective in inhibiting the growth of S. aureus, but not against Streptococcus pneumoniae. The test organism used in this study was Escherichia coli K12. H-Gly-Gly-Met-OH has been shown to have sequences that are similar to those found in kinetically slow peptides and tripeptides, which may explain its stability when encapsulated in liposomes for oral administration.</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molHypertrehalosaemic Neuropeptide (Heliothis zea)
CAS:<p>Heliothis zea Pyr-Leu-Thr-Phe-Ser-Ser-Gly-Trp-Gly-Asn -NH2 is a residue found in the hemolymph of Heliothis zea. It has been shown to have ligand uptake properties and can be used to measure lipid levels in the hemolymph. The chromatographic analysis of this protein has been performed with the use of assays that are specific for the receptor subtype. The ligand concentration was measured by the synthetic methods, which were developed from tobacco extracts. This protein is active at extracellular concentrations and has high affinity for trehalose, a carbohydrate.</p>Formula:C49H67N13O15Purity:Min. 95%Molecular weight:1,078.13 g/molH-Lys-Leu-OH·HBr
CAS:<p>Please enquire for more information about H-Lys-Leu-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H25N3O3·HBrPurity:Min. 95%Molecular weight:340.26 g/molFmoc-Gly-Phe-OH
CAS:<p>Fmoc-Gly-Phe-OH is a photolytic residue that has been synthesized by solid-phase techniques. This molecule is an immobilized linker that can be used in photolabile devices to analyze the kinetics of biological processes. Fmoc-Gly-Phe-OH can also be used in supramolecular devices and regenerative medicine to measure the diameter of cells, as well as for regenerative purposes in humans.</p>Formula:C26H24N2O5Purity:Min. 95%Molecular weight:444.48 g/molZ-D-Phe-Pro-OH
CAS:<p>D-Phe-Pro-OH is a tripeptide that is reversibly inactivated by methanol, chloromethyl ketone, and boronate esters. It can be used as an affinity label for the detection of aldehydes. This compound has been shown to be an inhibitor of protein synthesis and cell growth. It has also been used to synthesize analogs with similar properties, such as Z-D-Phe-Pro-OH.</p>Formula:C22H24N2O5Purity:Min. 95%Molecular weight:396.44 g/molZ-Val-Phe-OMe
CAS:<p>Z-Val-Phe-OMe is an efficient method for the synthesis of a benzyl ester, which is a precursor to the anti-leishmanial drug Z-Val-Phe. The reaction is carried out in chloroform in the presence of ethyl or benzyl esters and ammonium chloride. This methodology was developed to provide a systematic approach to synthesize this compound. The reaction proceeds through a serine protease catalyzed hydrolysis of the amide bond on the surface of leishmania. Kinetic data shows that Z-Val-Phe-OMe has an IC50 value of 0.87 μM for leishmania and is more active than Z-Val-Phe against L. major, L. mexicana, and L. braziliensis strains.</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/mol3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride
CAS:<p>3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride is a chlorinated, thermosetting emulsifier that is used in the production of pressure sensitive adhesives. This compound has a high viscosity and is used as a retardant and an emulsifier. It is also used as a trichloride to produce vinyl chloride monomer. 3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride inhibits the growth of bacteria by acting as an antimicrobial agent. The mechanism of action for this compound is not fully understood but it has been shown to inhibit protein synthesis in bacteria.</p>Formula:C11H6Cl3NO2Purity:Min. 95%Molecular weight:290.53 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/molH-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Proadrenomedullin (1-20) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H177N37O28Purity:Min. 95%Molecular weight:2,477.83 g/molZ-Ala-Tyr-OH
CAS:<p>Please enquire for more information about Z-Ala-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O6Purity:Min. 95%Molecular weight:386.4 g/mol1,2-Dihydro-1-Methyl-5-(Trifluoromethyl)-3H-Pyrazol-3-One
CAS:<p>Please enquire for more information about 1,2-Dihydro-1-Methyl-5-(Trifluoromethyl)-3H-Pyrazol-3-One including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H5F3N2OPurity:Min. 95%Molecular weight:166.1 g/molA-VI-5 acetate salt
CAS:<p>Please enquire for more information about A-VI-5 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H40N6O10Purity:Min. 95%Molecular weight:548.59 g/molAc-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2
CAS:<p>Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 is a synthetic chemokine that is a member of the CXC subfamily. Chemokines are small proteins that have a hydrophobic region, which allows them to insert into membranes. This chemokine has been shown to be capable of forming dimers in the presence of other chemokines and exhibits a high degree of homology with congener chemokines. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence has been shown to denature at pH 8 and has water solubility; however, it does not dissolve in lipid bilayers such as phospholipid bilayers or monolayers. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence is also stable in an Alzheimer's disease mouse model.</p>Formula:C39H59N7O6Purity:Min. 95%Molecular weight:721.93 g/molMyelin Basic Protein (87-99) (human, bovine, rat)
CAS:<p>Please enquire for more information about Myelin Basic Protein (87-99) (human, bovine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O17Purity:Min. 95%Molecular weight:1,555.82 g/molAloc-Ala-OH·DCHA
CAS:<p>Aloc-Ala-OH·DCHA is a linker that can be utilized in nucleotide synthesis. It is synthesized by reacting the amine group of alanine with the acid chloride of DCHA. The product of this reaction, Aloc-Ala-OH·DCHA, is an amide bond with a free hydroxyl group on one end and a free amino group on the other end. The C-terminal carboxylic acid function of this compound reacts with phosphoramidite to yield the desired n-terminal threonine residue. This linker can also be used to conjugate other compounds such as nucleosides or phosphodiester bonds.</p>Formula:C7H11NO4·C12H23NPurity:Min. 95%Color and Shape:SolidMolecular weight:354.48 g/molH-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Gln-Ala-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Boc-Gln-Ala-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O8·HClPurity:Min. 95%Molecular weight:667.15 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molSPARC (119-122) (mouse) acetate salt
CAS:<p>SPARC (119-122) (mouse) is an acetate salt of H-Lys-Gly-His-Lys-OH. SPARC (119-122) has been shown to be a mimetic of the c-terminal region of the protein SPARC and can bind to many metal ions including Zn2+, Mn2+, Cu2+, Co2+, Ni2+ and Mg2+. The binding affinity for these metals is dose dependent, with saturation occurring at high concentrations. This property may make this compound a therapeutic target for drug discovery strategies.</p>Formula:C20H36N8O5Purity:Min. 95%Molecular weight:468.55 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O2·2HClPurity:Min. 95%Molecular weight:432.35 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molH-DL-Leu-DL-Ala-OH
CAS:<p>Please enquire for more information about H-DL-Leu-DL-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18N2O3Purity:Min. 95%Molecular weight:202.25 g/mol4-(Fmoc-hydrazino)-benzoylaminomethyl resin (200-400 mesh)
<p>Please enquire for more information about 4-(Fmoc-hydrazino)-benzoylaminomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Formula:C30H44N8O4Purity:Min. 95%Molecular weight:580.72 g/molFmoc-[D4]Ala-OH
CAS:Controlled Product<p>Please enquire for more information about Fmoc-[D4]Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H13D4NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:315.35 g/molH-D-Met-Met-Met-OH
CAS:<p>Please enquire for more information about H-D-Met-Met-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H29N3O4S3Purity:Min. 95%Molecular weight:411.61 g/mol(1-Methyl-1H-pyrazol-4-yl)boronic acid
CAS:<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>Formula:C4H7BN2O2Purity:Min. 95%Molecular weight:125.92 g/molH-Gly-Gly-Glu-Ala-OH
CAS:<p>H-Gly-Gly-Glu-Ala-OH is a carboxylate. It has been shown to be an ionizable molecule with a proton that can exist in either the hydrated or dehydrated form. The proton of the carboxylate group can move between the two forms and the ionization state depends on pH and temperature. H-Gly-Gly-Glu-Ala-OH is a linear peptide, which means it has an amide group and a residue at each end of the chain. Each of these residues has specific conformations, which are impacted by intramolecular hydrogen bonds. These conformations play a role in determining its pharmacological properties, as well as its function in structural biology and magnetic resonance techniques. H-Gly-Gly-Glu-Ala-OH also has population distribution studies that have been used for diffraction analyses, as well as for titration experiments.</p>Formula:C12H20N4O7Purity:Min. 95%Molecular weight:332.31 g/molFmoc-Gln(Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Gln(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Asp(Glu-OH)-OH
CAS:<p>Ac-Asp(Glu-OH)-OH is a low potency, but potentiating compound that binds to the cell cytoplasm. It inhibits the uptake of glutamate into the synaptic cleft by binding to acidic granules. This compound may be neuroprotective and inhibit prostate carcinoma growth. Ac-Asp(Glu-OH)-OH has also been shown to inhibit postsynaptic potentials and decrease glutamate release in cerebellar granule cells.</p>Formula:C11H16N2O8Purity:Min. 95%Molecular weight:304.25 g/mol(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H303N59O53Purity:Min. 95%Molecular weight:4,309.85 g/molStaphylococcus Aureus Protein A (SpA)-Derived Peptide
CAS:<p>Please enquire for more information about Staphylococcus Aureus Protein A (SpA)-Derived Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H118N20O22Purity:Min. 95%Molecular weight:1,567.79 g/molDL-Phenylalaninol
CAS:<p>DL-Phenylalaninol is a chemical compound with the molecular formula CHNO. It is a white to pale yellow solid that is soluble in water and methanol, but not in diethyl ether. DL-Phenylalaninol has been synthesized by reacting cycloleucine with l-phenylalaninol. The reaction solution was heated at a temperature of 140°C for six hours, which yielded DL-Phenylalaninol as a hydroxy methyl compound. The synthesis of DL-Phenylalaninol was achieved through an asymmetric synthesis with sodium dodecyl sulfate surfactant. A detection sensitivity of 1 ppm and an enhancement at 260 nm were observed when analyzing the product by high performance liquid chromatography (HPLC).</p>Formula:C9H13NOPurity:Min. 95%Molecular weight:151.21 g/molNα-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide
CAS:<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>Formula:C12H15FN4O5Purity:Min. 95%Color and Shape:Off-White To Yellow SolidMolecular weight:314.27 g/molZ-Trp-Ala-OH
CAS:<p>Z-Trp-Ala-OH is an imidazolide that is used as a potassium supplement. It has the potential to be used in the treatment of epilepsy, but more research is needed to determine its safety and efficacy.</p>Formula:C22H23N3O5Purity:Min. 95%Molecular weight:409.44 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/molEnterostatin (human, mouse, rat) acetate salt
CAS:<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>Formula:C21H36N8O6Purity:Min. 95%Molecular weight:496.56 g/molCyclo(-Pro-Gly)3
CAS:<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O6Purity:Min. 95%Molecular weight:462.5 g/molHCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H116N20O17Purity:Min. 95%Molecular weight:1,425.72 g/molH-Gly-Arg-Asp-Gly-Ser-OH
CAS:<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molFmoc-p-phenyl-L-phenylalanine
CAS:<p>Fmoc-p-phenyl-L-phenylalanine (FMPP) is a fluorescent probe that can be used to detect and diagnose damage in tissues. It is a small molecule that has been shown to bind to myocytes and cardiac tissues, specifically targeting skeletal and cardiac muscle. FMPP binds to the amino acid phenylalanine, which is found in high concentrations in cardiac tissue. This binding causes an increase in fluorescence, which can be detected by light microscopy or flow cytometry. FMPP has been used to detect damage in heart muscles of mice with dilated cardiomyopathy and also as a probe for myocardial infarctions in humans.</p>Formula:C30H25NO4Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:463.52 g/molSuc-Ala-Ala-Pro-Phe-SBzl
CAS:<p>Suc-Ala-Ala-Pro-Phe-SBzl is a synthetic peptide with a sequence similar to the signal peptide of procarboxypeptidase B2. It has been shown that Suc-Ala-Ala-Pro-Phe-SBzl can be used as a diagnostic tool for pancreatic cancer, because it is found in higher concentrations in the blood of patients with pancreatic cancer. This peptide also has an affinity for metal ions, which allows it to be used as a probe to detect the presence of these ions in solution. Suc-Ala-Ala-Pro-Phe-SBzl binds to human immunoglobulin G (IgG) and can be used in analytical methods that use x ray diffraction data.</p>Formula:C31H38N4O7SPurity:Min. 95%Molecular weight:610.72 g/molH-Met-Phe-OH
CAS:<p>H-Met-Phe-OH is a synthetic polymerase chain that has been shown to be effective in treatment trials for various diseases such as ventricular dysfunction, cancer, inflammatory diseases, and virus. H-Met-Phe-OH binds to the DNA template strand and initiates the synthesis of RNA from nucleotide triphosphates. This molecule also has chemotactic activity and can be used as a diagnostic tool for inflammation or cancer. H-Met-Phe-OH can also be used in biological samples to detect viruses or hepatitis B.</p>Formula:C14H20N2O3SPurity:Min. 95%Molecular weight:296.39 g/molH-Lys-Gly-Gly-OH hydrochloride salt
CAS:<p>Histidine is a non-essential amino acid that has been shown to be involved in the regulation of cell growth and differentiation. It is also involved in the biosynthesis of nucleotides, collagen, and carnitine. Kinetic studies on histidine have been done by acetylation of histidine with acetic anhydride and pyridine. The kinetic method used was based on the reaction between histidine and p-nitrophenyl phosphate. The transfer reactions were performed with a strain containing lysine residues which were then adsorbed onto a surface-enhanced Raman spectroscopy (SERS) substrate. These experiments were performed using techniques such as resonance mass spectrometry (RMS), surface-enhanced Raman spectroscopy (SERS), and protonation selective mass spectrometry (PSMS).</p>Formula:C10H20N4O4Purity:Min. 95%Molecular weight:260.29 g/molH-β-Ala-Ala-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O3Purity:Min. 95%Molecular weight:160.17 g/molH-D-Met-Met-OH
CAS:<p>H-D-Met-Met-OH is a synthetic compound, which is an optical isomer of DL-methionine. It has been shown to have the same biochemical and dietary concentrations as DL-methionine. H-D-Met-Met-OH has also been shown to have a linear response in bioassays, assays and other biochemical pathways. The thermodynamic properties of this compound are also similar to those of DL-methionine, although it is not as stable. This compound can be used as a substitute for DL-methionine because it has an identical chemical structure and can be converted into L -methionine by the enzyme methioninase.</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molZ-Lys(Z)-ONp
CAS:<p>Z-Lys(Z)-ONp is an intermediate in the synthesis of lysergic acid diethylamide (LSD). It is a hypotensive agent that has analgesic properties. Z-Lys(Z)-ONp has been patented for use as a hypotensive agent, although it has not yet been approved for this use.</p>Formula:C28H29N3O8Purity:Min. 95%Molecular weight:535.55 g/mol(Arg8)-Vasopressin (4-9)
CAS:<p>Please enquire for more information about (Arg8)-Vasopressin (4-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H44N12O8SPurity:Min. 95%Molecular weight:672.76 g/molH-Glu(EDANS)-Lys-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(DABCYL)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(EDANS)-Lys-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(DABCYL)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H124N22O15SPurity:Min. 95%Molecular weight:1,762.13 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formula:C61H110N24O14Purity:Min. 95%Molecular weight:1,403.68 g/molSyntide 2 trifluoroacetate salt
CAS:<p>Syntide 2 is a diacylglycerol, which has been found to have a number of biochemical properties. It is an activator of protein kinase C and has been shown to be reactive in vitro assays. Syntide 2 has also been found to activate the light chain kinase in plant physiology. This compound has also been shown to promote neuronal death and may have a role in transcriptional regulation. Syntide 2 is used as a model system for studying the physiological function of α subunit-containing proteins.</p>Formula:C68H122N20O18Purity:Min. 95%Molecular weight:1,507.82 g/molH-Tyr-Gly-NH2·HCl
CAS:<p>Please enquire for more information about H-Tyr-Gly-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O3·HClPurity:Min. 95%Molecular weight:273.72 g/mol(Tyr0)-C-Peptide (human)
CAS:<p>Please enquire for more information about (Tyr0)-C-Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H220N36O50Purity:Min. 95%Molecular weight:3,183.44 g/molZ-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Z-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H49FN10O6Purity:Min. 95%Molecular weight:676.78 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Formula:C23H38N6O5·2HClPurity:Min. 95%Molecular weight:551.51 g/molH-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-OH
CAS:<p>H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His (Daprodinam) is a peptide that binds to the response element in the promoter region of the gene encoding for the LDL receptor. Daprodinam inhibits atherosclerosis and has been shown to have an inhibitory effect on angiotensinogen production, which leads to decreased blood pressure. Daprodinam also has inhibitory properties against toll like receptor 4, which is involved in inflammatory bowel disease.</p>Formula:C79H116N22O17Purity:Min. 95%Molecular weight:1,645.9 g/molBoc-β-cyclohexyl-L-alanine
CAS:<p>Boc-beta-cyclohexyl-L-alanine is a synthetic peptide that has been shown to bind to the thrombin receptor and inhibit the activity of this enzyme. It blocks the interaction between thrombin and its receptor, thereby inhibiting thrombin’s ability to convert fibrinogen into fibrin. This inhibition prevents the formation of a blood clot, which is essential for hemostasis. Boc-beta-cyclohexyl-L-alanine has also been shown to be an anticoagulant with antiplatelet properties. It binds to chloride ions in the blood and prevents platelets from binding together, thus preventing aggregation and adhesion.</p>Formula:C14H25NO4Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:271.35 g/molH-Glu(Trp-OH)-OH
CAS:<p>H-Glu(Trp-OH)-OH is a synthetic immunomodulator that is used in vitro to study the immune system. H-Glu(Trp-OH)-OH has been shown to stimulate the production of antibodies by polyclonal antibodies, which inhibits the growth of bacteria. H-Glu(Trp-OH)-OH has also been shown to have anti-inflammatory properties and can inhibit lung damage caused by radiation. H-Glu(Trp-OH)-OH is not active against tuberculosis or other infectious diseases in animals because it does not cause an increase in phagocytic cells or leukocytes.</p>Formula:C16H19N3O5Purity:Min. 95%Molecular weight:333.34 g/molH-Lys-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N6O5Purity:Min. 95%Molecular weight:388.46 g/molSuc-Phe-Leu-Phe-SBzl
CAS:<p>Suc-Phe-Leu-Phe-SBzl is a protease inhibitor that blocks the activity of serine proteases and inhibits protein synthesis. It has been shown to be active against a number of proteases, such as trypsin, chymotrypsin, elastase, and cathepsin G. Suc-Phe-Leu-Phe-SBzl has been reported to inhibit the activity of serine proteases at low concentrations but not at high concentrations. This drug also has a potent effect on cellular organelles such as mitochondria and lysosomes. The enzyme inhibition property of Suc-Phe-Leu-Phe-SBzl is due to its ability to bind strongly to proteins with hydrophobic amino acid residues in their active site.</p>Formula:C35H41N3O6SPurity:Min. 95%Molecular weight:631.78 g/molH-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Phe-NH2 hydrochloride salt
CAS:<p>H-Arg-Phe-NH2 hydrochloride salt (H-RF) is a physiological agent that has been shown to have effects on the response element binding protein. H-RF is a small, water soluble molecule that has been shown to act as an agonist for peptides and cation channels in vitro. The peptides are involved in the regulation of cardiac function and locomotor activity, while the cation channel regulates the opening and closing of potassium channels. The binding of H-RF to these receptors leads to positive changes in energy metabolism, which may be due to its ability to activate ATPase. H-RF also binds strongly to disulfide bonds found in proteins such as peptide hormones and enzymes. These disulfide bonds are important for maintaining protein structure and function.</p>Formula:C15H24N6O2Purity:Min. 95%Molecular weight:320.39 g/molApelin-36 (human)
CAS:<p>Apelin-36 is a human apelin protein. It is involved in the regulation of appetite and energy expenditure. Apelin-36 has been shown to be an independent predictor of body mass index and insulin resistance in women with polycystic ovary syndrome. Apelin-36 is also an indicator of the risk for cardiovascular disease, stroke, and type 2 diabetes mellitus. This molecule can be measured using a Western blot assay method on ovary homogenates. The level of apelin-36 can be used as a diagnostic tool for determining insulin resistance and overweight status.</p>Formula:C184H297N69O43SPurity:Min. 95%Molecular weight:4,195.83 g/mol(Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O57S2Purity:Min. 95%Molecular weight:4,345.87 g/molZ-D-Arg(Z)2-OSu
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H35N5O10Purity:Min. 95%Molecular weight:673.67 g/molH-Pro-Asp-Val-Asp-His-Val-Phe-Leu-Arg-Phe-NH2
CAS:<p>H-Pro-Asp-Val-Asp-His-Val-Phe-Leu-Arg-Phe is a peptide that is synthesized from proctolin. It has been shown to have gland cell receptor activity and physiological effects in animals. HPAVH has been shown to inhibit the binding of specific antibody to its antigen and can be used as a receptor for various applications, such as a cation channel. This peptide has also been shown to inhibit the binding of carboxy terminal of the alpha subunit of the acetylcholine receptor and can be used for research in animals.</p>Formula:C59H86N16O14Purity:Min. 95%Molecular weight:1,243.41 g/molH-Ala-Phe-Gly-OH
CAS:<p>Please enquire for more information about H-Ala-Phe-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molH-Val-Tyr-Ser-betaNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Val-Tyr-Ser-betaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N4O5Purity:Min. 95%Molecular weight:492.57 g/molpTH (1-31) (human)
CAS:<p>Please enquire for more information about pTH (1-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H269N49O47S2Purity:Min. 95%Molecular weight:3,719.3 g/molFITC-β-Ala-Amyloid β-Protein (1-40)
CAS:<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C218H311N55O64S2Purity:Min. 95%Molecular weight:4,790.27 g/molBexagliflozin
CAS:<p>Bexagliflozin is a drug that is used to treat type II diabetes in adults. It helps to control blood sugar levels by inhibiting the enzyme DPP-IV and increasing insulin release from the pancreas. Bexagliflozin has been shown to be effective in lowering blood sugar levels in patients with chronic kidney disease and cancer, as well as those with a body mass index (BMI) of 30 or higher. This drug is an oral hypoglycaemic agent that can be used for diagnostic purposes. It has also been shown to be clinically effective for the treatment of diabetic nephropathy and diabetic retinopathy. The enantiomers of bexagliflozin can be differentiated according to their pharmacological properties, which may allow for more targeted therapy.</p>Formula:C24H29ClO7Purity:Min. 95%Molecular weight:464.94 g/molAc-Asp-Glu-Asp(EDANS)-Glu-Glu-Abu-L-lactoyl-Ser-Lys(DABCYL)-NH2 ammonium salt
CAS:<p>Please enquire for more information about Ac-Asp-Glu-Asp(EDANS)-Glu-Glu-Abu-L-lactoyl-Ser-Lys(DABCYL)-NH2 ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H89N15O25SPurity:Min. 95%Molecular weight:1,548.59 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/mol1-Phenyl-4,5-dihydro-1H-pyrazol-3-amine
CAS:<p>1-Phenyl-4,5-dihydro-1H-pyrazol-3-amine is an organic compound that is used as a reagent in the synthesis of other compounds. It is a dimeric compound that can be synthesized by electrolysis. It has been shown to have kinetic and potential properties, which are determined by its anilines and pyridines. 1-Phenyl-4,5-dihydro-1H-pyrazol-3-amine can also be synthesized from ethanolamine and copper (II) salts. This technique involves the electrochemical oxidation of copper, followed by reduction with acetonitrile. The resulting 1-(aminomethyl)-4,5 dihydro pyrazole 3 amine can then be used for further reactions.</p>Formula:C9H11N3Purity:Min. 95%Molecular weight:161.2 g/molHirudin (54-65) (sulfated)
CAS:<p>Hirudin is a protein that functions as an anticoagulant by binding to the active site of thrombin, preventing it from converting fibrinogen into fibrin. It has a high affinity for the thrombin receptor and can be modified in various ways. Hirudin's most common modification is sulfation, which enhances its anticoagulant activity. Hirudin is a proteolytic enzyme that can be synthesized using solid-phase chemistry. Its biological function is to inhibit blood coagulation by inhibiting the conversion of fibrinogen to fibrin. Hirudin binds to thrombin, preventing it from converting fibrinogen into fibrin and thus inhibits coagulation. It also prevents clot formation by inhibiting platelet aggregation, which may result from interactions with other proteins such as prothrombin and factor VIII.</p>Formula:C66H93N13O28SPurity:Min. 95%Molecular weight:1,548.58 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H276N54O55SPurity:Min. 95%Molecular weight:4,108.51 g/molFmoc-N-methyl-O-tert-butyl-L-tyrosine
CAS:<p>Fmoc-N-methyl-O-tert-butyl-L-tyrosine is a peptide that mimics the natural substrate serine protease. It has been used to study protein-protein interactions in proteases and their cleavage specificity. This peptide was designed as a peptidomimetic, which is an analog of a protein or peptide. The systematic synthesis of this molecule has been studied extensively and it has been shown that the maximum number of modifications occurs at the N terminus and the minimal number at the C terminus. The residue of this molecule is modified by proteolytic modification, which is a chemical modification that changes the amino acid sequence. Fmoc-N-methyl-O-tert-butyl-L-tyrosine has minimal quantified stability, which means that it can be quantified but not stable for long periods of time.</p>Formula:C29H31NO5Purity:Min. 95%Molecular weight:473.56 g/molAcetyl-Amylin (8-37) (human)
CAS:<p>Please enquire for more information about Acetyl-Amylin (8-37) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H218N42O46Purity:Min. 95%Molecular weight:3,225.48 g/mol(1S, 2R)-1-Phenyl-2-(1-pyrrolidinyl)-1-propanol
CAS:Controlled Product<p>Please enquire for more information about (1S, 2R)-1-Phenyl-2-(1-pyrrolidinyl)-1-propanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19NOPurity:Min. 95%Color and Shape:PowderMolecular weight:205.3 g/mol(Trp63,Trp64)-C3a (63-77)
CAS:<p>Please enquire for more information about (Trp63,Trp64)-C3a (63-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H134N26O18Purity:Min. 95%Molecular weight:1,820.15 g/molH-Gly-Leu-Tyr-OH
CAS:<p>H-Gly-Leu-Tyr-OH is a tripeptide that is found in some human and animal proteins. The peptide contains glycine, leucine, tyrosine, and hydroxyproline. It binds to copper ions with an inhibition constant of 1.5 x 10^5 M and has a pH optimum of 7.0. In the active form, it inhibits α subunit of bacterial aminopeptidase which is required for protein synthesis in bacteria. The peptide also has been shown to be a model system for the study of enzyme mechanisms and as a chromatographic method for analyzing proteins in food chemistry.</p>Formula:C17H25N3O5Purity:Min. 95%Molecular weight:351.4 g/molH-D-His(1-Me)-OH hydrochloride salt
CAS:<p>Please enquire for more information about H-D-His(1-Me)-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H11N3O2Purity:Min. 95%Molecular weight:169.18 g/molBoc-N-Me-D-Tyr-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21NO5·C12H23NPurity:Min. 95%Molecular weight:476.65 g/molH-Phe-Arg-Arg-OH acetate salt
CAS:<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>Formula:C21H35N9O4Purity:Min. 95%Molecular weight:477.56 g/molFmoc-Ile-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Ile-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/molH-D-Leu-Tyr-OH
CAS:<p>H-D-Leu-Tyr-OH is a biochemically reactive compound that can undergo a number of reactions with other substrates. It is an amide that is converted to the tripeptides, H-D-leu-tyr and H-D-Phe-Lys, by hydrolysis in the liver. It is also converted to the condensation products, H-D-leu and H2NCH2COOH, by hydrochloric acid or metal ions. The formation rate of this compound depends on its concentration. The rate of reaction increases with increased substrate concentrations. This compound has an acidic pH and binds to a bidentate ligand, histidine.</p>Formula:C15H22N2O4Purity:Min. 95%Molecular weight:294.35 g/molN-Boc-1,2-phenyldiamine
CAS:<p>N-Boc-1,2-phenyldiamine is a histone acetyltransferase (HAT) inhibitor. It is an acetylated molecule that contains two phenyl rings, one of which is substituted with an amine group. This compound was designed to inhibit the activity of HATs, which are enzymes involved in the chemical modification of histones and other proteins. N-Boc-1,2-phenyldiamine inhibits the activities of these enzymes and prevents the acetylation of lysines on histones or other proteins. It has been shown to be efficient in inducing apoptosis in human cancer cells and may also have some antitumor effects.</p>Formula:C11H16N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:208.26 g/molN-Methylmorpholine N-oxide - 50% w/w aqueous solution
CAS:<p>N-Methylmorpholine N-oxide is an activated cellulose product. It is used for the treatment of autoimmune diseases and can be used as a reagent to synthesize fatty acid esters. This drug has been shown to have low water permeability, meaning it does not readily diffuse through membranes, which may be due to its high hydrochloric acid content.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:117.15 g/molBoc-Ser(Ala-Fmoc)-OH
CAS:<p>Boc-Ser(Ala-Fmoc)-OH is a synthetic amino acid that is used in peptide synthesis. It is typically prepared by the condensation of Serine with diethyl Fmoc-amino acid and hydrochloric acid. This molecule has an efficient epimerization process, which allows for the synthesis of the other enantiomer, L-Ser(Ala-Fmoc)-OH. The synthetic method for Boc-Ser(Ala-Fmoc)-OH can be used to synthesize peptides from amino acids.</p>Formula:C26H30N2O8Purity:Min. 95%Molecular weight:498.53 g/mol(Des-Pyr 1,D-Ser(tBu)6,Azagly10)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Pyr 1,D-Ser(tBu)6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H79N17O12Purity:Min. 95%Molecular weight:1,158.31 g/molN-Acetyl-[Cys4,10, D-Phe7]-α-Melanocyte Stimulating Hormone Fragment 4-13
CAS:<p>Please enquire for more information about N-Acetyl-[Cys4,10, D-Phe7]-alpha-Melanocyte Stimulating Hormone Fragment 4-13 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H86N18O13S2Purity:Min. 95%Molecular weight:1,343.58 g/molGalanin (1-13)-Neuropeptide Y (25-36) amide
CAS:<p>Please enquire for more information about Galanin (1-13)-Neuropeptide Y (25-36) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H209N41O34Purity:Min. 95%Molecular weight:2,962.37 g/molH-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H61N11O9SPurity:Min. 95%Molecular weight:848.03 g/molPACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C142H224N40O39SPurity:Min. 95%Molecular weight:3,147.61 g/mol...(Ala13)-Apelin-13 (human, bovine, mouse, rat) trifluoroacetate salt
CAS:<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>Formula:C63H107N23O16S·xC2HF3O2Purity:Min. 95%Molecular weight:1,474.74 g/mol2-O-Benzyl-3-O-allyl-sn-glycerol
CAS:<p>Please enquire for more information about 2-O-Benzyl-3-O-allyl-sn-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H18O3Purity:Min. 95%Molecular weight:222.28 g/molH-Arg-Lys-Gly-Asp-Ile-Lys-Ser-Tyr-pNA
CAS:<p>Please enquire for more information about H-Arg-Lys-Gly-Asp-Ile-Lys-Ser-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H75N15O14Purity:Min. 95%Molecular weight:1,086.2 g/molFmoc-Leu-Thr(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Leu-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H34N2O6Purity:Min. 95%Molecular weight:494.58 g/molCopeptin (rat) trifluoroacetate salt
CAS:<p>Copeptin (rat) trifluoroacetate salt is a peptide that belongs to the group of protein inhibitors. It can inhibit the activity of the acetylcholine receptor, which leads to an increase in muscle tone and rigidity. Copeptin is also used as a research tool for studying protein interactions, antibody-antigen reactions, cell biology, ligand-receptor binding, pharmacology and life sciences. Copeptin has been shown to inhibit ion channels such as nicotinic receptors and potassium channels. The CAS number for copeptin (rat) trifluoroacetate salt is 86280-64-0.</p>Formula:C183H307N57O61Purity:Min. 95%Molecular weight:4,281.74 g/mol(β-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H56N8O10SPurity:Min. 95%Molecular weight:780.93 g/molPACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>Formula:C203H331N63O53SPurity:Min. 95%Molecular weight:4,534.26 g/mol(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester
CAS:<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>Formula:C12H16O3Purity:Min. 95%Color and Shape:LiquidMolecular weight:208.25 g/molZ-His-Leu-OH
CAS:<p>Please enquire for more information about Z-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N4O5Purity:Min. 95%Molecular weight:402.44 g/molH-Leu-Ser-Ala-Leu-OH
CAS:<p>H-Leu-Ser-Ala-Leu-OH is a chemical compound that has been shown to bind to 5-HT1B receptors. This receptor belongs to the 5HT1 family of serotonin receptors, which are G protein coupled receptors. The 5HT1B receptor has been shown to have a role in locomotor activity and dopamine release. HLSALLOH is also a specific antibody that reacts with the 5HT1B receptor in rats. The location of this receptor is on the dorsal raphe nucleus and other parts of the brainstem. HLSALLOH has a pH optimum of 6.0 and can be used as an immunogen for polyclonal antibodies against 5HT1B receptors.</p>Formula:C18H34N4O6Purity:Min. 95%Molecular weight:402.49 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/molPre-S2 (1-26)
CAS:<p>Please enquire for more information about Pre-S2 (1-26) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H199N39O37SPurity:Min. 95%Molecular weight:2,944.29 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/molAc-Met-Asp-Lys-Val-Leu-Asn-Arg-Glu-OH
CAS:<p>Please enquire for more information about Ac-Met-Asp-Lys-Val-Leu-Asn-Arg-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H75N13O15SPurity:Min. 95%Molecular weight:1,046.2 g/mol(Pyr 1)-Opiorphin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H45N11O8Purity:Min. 95%Molecular weight:675.74 g/molBoc-4-Abz-OSu
CAS:<p>Please enquire for more information about Boc-4-Abz-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N2O6Purity:Min. 95%Molecular weight:334.32 g/molBoc-Ser(Val-Fmoc)-OH
CAS:<p>Boc-Ser(Val-Fmoc)-OH is a biomolecule that is used for the synthesis of peptides. It has been shown to be an efficient synthetic method for the synthesis of peptides and isopeptides. The use of this biomolecule in peptide synthesis allows for the production of large quantities of peptides without racemization or epimerization that can occur with other methods. This synthetic method provides a means to produce both amino acid and dipeptide sequences, as well as the incorporation of non-natural amino acids.</p>Formula:C28H34N2O8Purity:Min. 95%Molecular weight:526.58 g/molN-Me-Thr(Bzl)-OH·HCl
CAS:<p>N-Me-Thr(Bzl)-OH·HCl is a soluble, hydroformylation catalyst with alkenyl and sulfonated substituents. It is used as a hydrogenation catalyst in the industrial production of polymers, detergents, and other organic chemicals. It can also be used to catalyze the reduction of carbonyl groups to alcohols in organic synthesis.<br>N-Me-Thr(Bzl)-OH·HCl is insoluble in water and can be converted into an insoluble form by reacting with HCl or NaOH. This product has been shown to have radical properties that allow it to catalyze the hydrogenation of alkenes and alkynes.</p>Formula:C12H17NO3·HClPurity:Min. 95%Molecular weight:259.73 g/molH-Asp-Arg-OH
CAS:<p>H-Asp-Arg-OH is a histamine releasing factor. Histamine is a neurotransmitter that regulates the release of other neurotransmitters in the brain. It also has been shown to be an important mediator of inflammatory reactions and has been associated with asthma, allergic reactions, and inflammation. H-Asp-Arg-OH can be used as a histological stain for the detection of 8-hydroxyquinoline and its metabolites such as glucuronides in tissues. The distribution pattern of this compound can be visualized using infrared spectroscopy and β-glucuronidase activity can be detected by color change in histochemical reactions.</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Formula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/mol7α-Methyl-3,3-dimethoxy-5(10)-estrene-17-one
CAS:Controlled Product<p>Please enquire for more information about 7alpha-Methyl-3,3-dimethoxy-5(10)-estrene-17-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H32O3Purity:Min. 95%Color and Shape:PowderMolecular weight:332.48 g/molZ-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/molH-Gly-Gly-pNA·HCl
CAS:<p>Please enquire for more information about H-Gly-Gly-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12N4O4·HClPurity:Min. 95%Molecular weight:288.69 g/molLysine(succinyl)-OH
CAS:<p>Lysine(succinyl)-OH, also known as N6-(3-carboxypropanoyl)-L-lysine, is a research chemical that falls under the category of amino acids. It is a derivative of lysine and has been widely used in various research studies. Lysine(succinyl)-OH is commonly used as a substrate for dehydrogenase enzymes and has been found to play a role in metabolic pathways. In addition to its research applications, Lysine(succinyl)-OH has also shown potential benefits for external use. It has been found to have moisturizing properties that can help improve the appearance of dry or damaged cuticles. Its succinyl group enhances its ability to penetrate the skin, providing deep hydration and nourishment. Lysine(succinyl)-OH is encoded by specific genes and expressed in various organisms. Its presence in different biological systems suggests its significance in cellular processes. In addition to its use as a</p>Formula:C10H18N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:246.26 g/mol4-(2'-N-Boc-hydrazino)benzoic acid
CAS:<p>Please enquire for more information about 4-(2'-N-Boc-hydrazino)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/molN-Me-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-Me-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H29N3O2Purity:Min. 95%Molecular weight:319.44 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/mol4-Bromo-2-methylthiophene
CAS:<p>4-Bromo-2-methylthiophene is a linker that is used in the synthesis of metal carbonyls. It has been shown to be an efficient cross-linking agent for the preparation of polymers. 4-Bromo-2-methylthiophene can be isomerized to 2,5-dimethylthiophene by heating it with hydroxylamine. 4-Bromo-2-methylthiophene can also catalyze the alkylation of nucleophiles such as ammonia and dimethyl sulfate, as well as nucleophilic attack on carboxylic acid derivatives. This compound is acidic, due to its chloride substituent, which can react with basic groups such as hydroxyl groups or amines.</p>Formula:C5H5BrSPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:177.06 g/molRFRP-3 (rat)
CAS:<p>Please enquire for more information about RFRP-3 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H134N26O25S2Purity:Min. 95%Molecular weight:2,020.3 g/mol4-Formyl-phenyloxymethyl polystyrene resin (200-400 mesh)
<p>4-Formylphenyloxymethyl polystyrene resin (200-400 mesh) is a polymer that can be used in the synthesis of amide, aminoacylation, halides, piperidine, yields, imine, reductive amination and heterocycles. It has been shown to be especially useful for the synthesis of diazepinones. The resin is soluble in solvents such as dichloromethane and ethanol. 4-Formylphenyloxymethyl polystyrene resin can be prepared by reacting styrene with formaldehyde and phenol in a solvent such as tetrahydrofuran or pyridine at a temperature between 0°C and 50°C. This process is usually conducted under an inert atmosphere such as nitrogen or argon gas. The resin is then washed with diethylether followed by benzene to remove residual formaldehyde.</p>Purity:Min. 95%ACV trifluoroacetate salt
CAS:<p>ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.</p>Formula:C14H25N3O6SPurity:Min. 95%Molecular weight:363.43 g/molL-Lysine L-malate
CAS:<p>L-Lysine L-malate is a chemical compound that is used in wastewater treatment. It inhibits the activity of enzymes such as carbon disulphide oxidase, copper complexes, and cationic surfactants. L-Lysine L-malate can be synthesized from sodium citrate and malonic acid by reacting with hydrogen peroxide to form a bicyclic heterocycle. This compound has been shown to have biological effects on metabolic disorders in animal studies, which may be due to its ability to inhibit the synthesis of fatty acids and proteins. The adsorption mechanism for this product is unknown.</p>Formula:C6H14N2O2·C4H6O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:280.28 g/molFibronectin CS-1 Fragment (1978-1982)
CAS:<p>Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is a heterocyclic peptide that has inhibitory effects on the muscle cells. It inhibits the enzyme guanosine triphosphatase, which is responsible for releasing calcium ions from its intracellular storage site. Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is an analog of the human protein fibronectin, and it can be used as a synthetic molecule to study how integrin receptors interact with different sequences of amino acids.</p>Formula:C26H45N5O10Purity:Min. 95%Molecular weight:587.66 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/mol((Cys31, Nva 34)-Neuropeptide Y (27-36))2
CAS:<p>Please enquire for more information about ((Cys31, Nva 34)-Neuropeptide Y (27-36))2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H186N36O28S2Purity:Min. 95%Molecular weight:2,597.08 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molFmoc-Glu(OtBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Boc-amino-2,6-dioxopiperidine
CAS:<p>Please enquire for more information about 3-Boc-amino-2,6-dioxopiperidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H16N2O4Purity:Min. 95%Molecular weight:228.25 g/molZ-Asu (OtBu)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H29NO6·C12H23NPurity:Min. 95%Molecular weight:560.77 g/molDABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H97N17O18SPurity:Min. 95%Molecular weight:1,532.72 g/molN,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine)
CAS:<p>Please enquire for more information about N,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2Purity:Min. 95%Color and Shape:PowderMolecular weight:168.28 g/molFmoc-Trp(Boc)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Trp(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H195N37O37Purity:Min. 95%Molecular weight:2,832.13 g/molFor-Met-Leu-Phe-OMe
CAS:<p>For-Met-Leu-Phe-OMe is a drug that has been shown to have anti-inflammatory properties in human cells. For-Met-Leu-Phe-OMe inhibits the production of inflammatory molecules, such as gamma-aminobutyric acid, and it also blocks the binding of leukotrienes to their receptors. These effects are due to its conformational properties, which allow it to bind to the receptor site and inhibit the binding of other molecules. For-Met-Leu-Phe-OMe has been shown to enhance the release of nucleotide levels and intracellular calcium concentration in vitro. It also binds to receptors on cells, which may be due to its biochemical properties or its analogues with other drugs.</p>Formula:C22H33N3O5SPurity:Min. 95%Molecular weight:451.58 g/mol(R)-2-Methylmorpholine hydrochloride
CAS:<p>Please enquire for more information about (R)-2-Methylmorpholine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H12ClNOPurity:Min. 95%Molecular weight:137.61 g/molH-Pro-Val-Asp-OH
CAS:<p>Please enquire for more information about H-Pro-Val-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H23N3O6Purity:Min. 95%Molecular weight:329.35 g/mol2-Fluoro-6-methoxybenzonitrile
CAS:<p>2-Fluoro-6-methoxybenzonitrile (2FMN) is a compound that is used as a starting material for the synthesis of other pharmaceuticals. It has been shown to bind to the acetylcholine receptor by using vibrational spectroscopy and functional theory. It also has been shown to be an effective chemokine inhibitor. Computational methods were used to optimize 2FMN's binding affinity for the acetylcholine receptor, and it was found that 2FMN binds with a dipole orientation in order to increase its binding affinity.</p>Formula:C8H6FNOPurity:Min. 95%Color and Shape:PowderMolecular weight:151.14 g/molN-α-Fmoc-β-(1-boc-piperidin-4-yl)-dl-alanine
CAS:<p>Please enquire for more information about N-alpha-Fmoc-beta-(1-boc-piperidin-4-yl)-dl-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H34N2O6Purity:Min. 95%Molecular weight:494.58 g/molZ-Ala-Ser-OH
CAS:<p>Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.</p>Formula:C14H18N2O6Purity:Min. 95%Color and Shape:PowderMolecular weight:310.3 g/molCholecystokinin Octapeptide (1-6) (desulfated)
CAS:<p>Please enquire for more information about Cholecystokinin Octapeptide (1-6) (desulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H47N7O10S2Purity:Min. 95%Molecular weight:801.93 g/molH-Gly-Arg-OH
CAS:<p>H-Gly-Arg-OH is a hydrophobic molecule that is structurally similar to the amino acid composition of casein. It has been shown to be an efficient method for the isolation of casein from milk. H-Gly-Arg-OH binds reversibly to casein and can be used as a reagent in immunoaffinity chromatography and filtration. The residue obtained after enzymatic activity can be used for polyacrylamide gel electrophoresis.</p>Formula:C8H17N5O3Purity:Min. 95%Molecular weight:231.25 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/mol(D-Ala2)-Leu-Enkephalin
CAS:<p>(D-Ala2)-Leu-Enkephalin H-Tyr-D-Ala-Gly-Phe-Leu-OH is a peptide that is a member of the endorphin family of endogenous analgesic compounds. It has been shown to have anti-inflammatory properties in clinical studies and to suppress bacterial growth in vitro. The compound has been implicated in the regulation of glucose homeostasis, as well as having an effect on body mass index and skin cells. (D-Ala2)-Leu-Enkephalin H-Tyr-D-Ala-Gly-Phe-Leu-(OH) is thought to modulate the activity of Toll like receptor 4, which is involved in inflammation and immune response.</p>Formula:C29H39N5O7Purity:Min. 95%Molecular weight:569.65 g/molH-Asp-Ala-OH
CAS:<p>Adriamycin is an anticancer drug that is a structural analogue of aspartic acid. It can be synthesized in a solid-phase synthesis using a polymeric resin with an acidic functional group, such as H-Asp-Ala-OH. Adriamycin inhibits the production of inflammatory cytokines and prostaglandins, which are involved in the development of inflammatory diseases. Adriamycin has been shown to have anti-inflammatory effects on human serum and to inhibit the production of proteins important for tumor cell proliferation. Adriamycin also has anti-inflammatory properties due to its ability to bind with hydrogen bonds to acidic residues on proteins.<br>END></p>Formula:C7H12N2O5Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:204.18 g/mol(H-Cys-pNA)2 (Disulfide bond)
CAS:<p>H-Cys-pNA is a labile molecule that has been used as a substrate for aminopeptidase activity. It is a competitive inhibitor of aminopeptidase and binds to the active site of the enzyme, preventing it from cleaving peptides from their amino acids. H-Cys-pNA has been shown to inhibit oxytocin release by binding to the oxytocin receptor in rat brain tissue. This molecule also inhibits the growth of dysgerminoma cells in vitro and blocks cell division. H-Cys-pNA is susceptible to proteolytic degradation and may be degraded by polyacrylamide gel electrophoresis, which can be used for its analysis on polyacrylamide gels.</p>Formula:C18H20N6O6S2Purity:Min. 95%Molecular weight:480.52 g/mol2-Isobutyl-3-methoxypyrazine
CAS:<p>2-Isobutyl-3-methoxypyrazine is a hydrophobic compound that is not soluble in water. It has a bound form and can be titrated with calorimetry. 2-Isobutyl-3-methoxypyrazine is synthesized by reacting 2,2,4-trimethylpentane with methoxyacetone in the presence of sodium methylate. The compound has been detected as an odorant in numerous plant species and is believed to play a role in plant physiology. 2-Isobutyl-3-methoxypyrazine has been shown to have potent antiviral activity against infectious diseases such as HIV, herpes simplex virus type 1 (HSV1), and varicella zoster virus (VZV). This specific antiviral activity may be due to its ability to bind fatty acids by hydrogen bonds, which may interfere with the synthesis of viral membranes.</p>Formula:C9H14N2OPurity:Min. 95%Molecular weight:166.22 g/molFmoc-Lys-OH·HCl
CAS:<p>Fmoc-Lys-OH·HCl is an acidic pyrylium that has been shown to be a potent inhibitor of tumor vasculature. It binds to the human serum albumin and inhibits the binding of ligands to the receptor tyrosine kinases, which are involved in brain tumor proliferation. Fmoc-Lys-OH·HCl has also been shown to inhibit the growth of cancer cells by binding to cell membrane receptors and inhibiting protein synthesis. This compound is also isomeric, meaning it can exist in different forms with different properties.</p>Formula:C21H24N2O4·HClPurity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:404.89 g/molFormyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N17O12Purity:Min. 95%Molecular weight:1,228.36 g/molAllatotropin
CAS:<p>Allatotropin is a diagnostic agent that belongs to the class of antimicrobial peptides. It has been shown to have strong activity against Gram-positive and Gram-negative bacteria. Allatotropin inhibits the growth of bacteria by binding to the external membrane, disrupting its integrity. Allatotropin also has been shown to increase gamma-aminobutyric acid levels in brain tissue and galleria mellonella larvae when injected subcutaneously. This may be due to its ability to activate GABA receptors. Allatotropin can be synthesized in vitro by combining β-amino acids with fatty acids and terminal residues, such as lysine, arginine, and glutamine, under conditions that mimic those found in living cells. This synthetic process yields a mixture of allatotropins with varying chain lengths and amino acid sequences.</p>Formula:C65H103N19O17S2Purity:Min. 95%Molecular weight:1,486.76 g/molH-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn-OH
CAS:<p>H-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn is a cytosolic protein that is an inhibitor of protein synthesis. It has been shown to inhibit the activity of proteases, such as caspase 1, and to activate caspase 1. This inhibition is consequent to the inhibition of polypeptide chain elongation and may be due to the ability of HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH to bind to peptidyl transferase or other proteins involved in protein synthesis. HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH binds to primary keratinocytes and k562 cells more efficiently than it does to thp1 cells, suggesting that it may have a role in skin cancer.</p>Formula:C68H105N21O23Purity:Min. 95%Molecular weight:1,584.69 g/molN-α-Allyloxycarbonyl-N-ε-2-Fmoc-L-lysine
CAS:<p>The synthesis of semaglutide is accomplished by a solid-phase synthetic route. The peptide is synthesized on a polymeric support. The side chains are assembled in the liquid phase and then condensed with the peptide chain. The condensation reaction between the side chains and peptide chain is catalyzed by an acid such as trifluoroacetic acid or ethyl chloroformate. Semaglutide was synthesized using this method to produce high purity, concentration, and yield.</p>Formula:C25H28N2O6Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:452.5 g/molH-Gly-His-OH·HCl
CAS:<p>H-Gly-His-OH·HCl is a methyl ester of histidine. It has an axial orientation, and the optical rotation is +25.4° (c=1 in methanol). H-Gly-His-OH·HCl is synthesized from glutamic acid, glutamate, and imidazole by using a method based on the catalytic properties of copper. H-Gly-His-OH·HCl can be used as a ligand for the enzyme peroxidase, which catalyzes oxidation reactions with hydrogen peroxide or organic peroxides to form water and oxidized products. The efficiency of this reaction increases with increasing concentrations of H-Gly-His-OH·HCl.<br>!--END--></p>Formula:C8H12N4O3·HClPurity:Min. 95%Molecular weight:248.67 g/molH-D-Ile-Asp-OH
CAS:<p>Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O5Purity:Min. 95%Molecular weight:246.26 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molMyeloblastin (142-150) (human, mouse) trifluoroacetate salt
CAS:<p>Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr-Val-OH trifluoroacetate salt is an antigen that belongs to the class of serine proteinases. It is a soluble recombinant human proteinase that has been shown to have a tumor cell lysis activity in vitro and in vivo. Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr Val is also a leukocyte antigen and can be used for the development of cancer vaccines.</p>Formula:C45H79N11O15Purity:Min. 95%Molecular weight:1,014.17 g/molH-Ala-Pro-4MbetaNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Pro-4MbetaNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H23N3O3·HClPurity:Min. 95%Molecular weight:377.86 g/molH-Gly-DL-Abu-OH
CAS:<p>Please enquire for more information about H-Gly-DL-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H12N2O3Purity:Min. 95%Molecular weight:160.17 g/molH-Tyr-Ser-NH2·HCl
CAS:<p>Please enquire for more information about H-Tyr-Ser-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N3O4·HClPurity:Min. 95%Molecular weight:303.74 g/mol(D-Ala2)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molAtrial Natriuretic Factor (1-24) (frog)
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (1-24) (frog) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H165N37O34S3Purity:Min. 95%Molecular weight:2,561.84 g/mol
