
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,464 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38247 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Ala-Ala-Tyr-Ala-Ala-OH
CAS:<p>H-Ala-Ala-Tyr-Ala-Ala-OH is a butanedione that hydrolyzes to form acetaldehyde. It is a chaperone and amide that, in the presence of water, forms peptides. The kinetic constants are dependent on the pH of the reaction. This product has been shown to have proctolin activity and is an enkephalinase inhibitor, which is involved in pain sensation. H-Ala-Ala-Tyr-Ala-Ala-OH has been used as an ion exchanger and carboxylate isomerizing agent.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molZ-Phe-Glu-OH
CAS:<p>Please enquire for more information about Z-Phe-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H24N2O7Purity:Min. 95%Molecular weight:428.44 g/molAcarbose 1,1-a,a-glycoside
CAS:<p>Please enquire for more information about Acarbose 1,1-a,a-glycoside including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H43NO18Purity:Min. 95%Molecular weight:645.6 g/molH-Pro-Leu-Gly-pNA
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H27N5O5Purity:Min. 95%Molecular weight:405.45 g/molBoc-trans-4-aminocyclohexane acetic acid
CAS:<p>Please enquire for more information about Boc-trans-4-aminocyclohexane acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO4Molecular weight:257.33 g/molZ-Gly-Gly-His-OH
CAS:<p>Z-Gly-Gly-His-OH is a synthetic amino acid that has been shown to bind to metal ions such as copper and zinc. The interaction with the metals may be due to the presence of the carboxyl group on the side chain. Z-Gly-Gly-His-OH is also able to catalyze the hydrolysis of ester bonds in organic solvents, which may be due to its interactions with cations. Z-Gly-Gly-His-OH can also interact with enzymes such as protein kinases, leading to changes in enzyme activity.</p>Formula:C18H21N5O6Purity:Min. 95%Molecular weight:403.39 g/molN-α-Fmoc-Nε-allyloxycarbonyl-D-lysine
CAS:<p>N-alpha-Fmoc-Nepsilon-allyloxycarbonyl-D-lysine is a medicament that is modified with an amino group at the alpha position. It is synthesized by modification of the chain with a ganirelix acetate. N-alpha-Fmoc-Nepsilon-allyloxycarbonyl-D-lysine can be used to produce ganirelix, which inhibits the release of follicle stimulating hormone (FSH). The chemical synthesis of this drug has been shown to be successful in large scale production, and it has been shown to be effective in treating patients with prostate cancer. Impurities in this drug have been found and treated by removing the methyl ester group from the lysine residue.</p>Formula:C25H28N2O6Purity:Min. 95%Molecular weight:452.5 g/molCaerulein (desulfated)
CAS:<p>Caerulein (desulfated) Pyr-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe-NH2 is a decapeptide that is found in the Australian frog, Caerulea. It has been shown to be a potent extractant of ionic materials and can be used in the separation of proteins by ion exchange chromatography. The sequence is as follows: Caerulein (desulfated) Pyr-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe. It has an acid composition of Cys, Asp, Tyr, Glu, Pro, Gly, Phe and Met. The amino acid composition is Pro, Ala, Gly, Val, Gln and Leu. Caerulein (desulfated) Pyr-Gln has been shown to have antihypertensive effects due to</p>Formula:C58H73N13O18SPurity:Min. 95%Molecular weight:1,272.34 g/molL-Phenylalanine methyl ester
CAS:<p>Phenylalanine methyl ester is a metabolite of phenylalanine that is formed by the action of the enzyme phenylalaninase. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of pro-inflammatory cytokines such as colony-stimulating factor (CSF) and tumor necrosis factor alpha (TNFα). This drug also inhibits amyloid protein aggregation, a process that causes Alzheimer's disease. Phenylalanine methyl ester has been used in clinical trials for treating infectious diseases. The drug increases the number of white blood cells in the body and stimulates antibody production. Phenylalanine methyl ester binds to sodium citrate and forms stable complexes with hydrogen bonds or ionic interactions.</p>Formula:C10H13NO2Purity:Min. 95%Molecular weight:179.22 g/mol1-Phenyl 1H-5-(2'-hydroxyphenyl)pyrazole
CAS:<p>1-Phenyl 1H-5-(2'-hydroxyphenyl)pyrazole (1PHPP) is a fine chemical that has been used in research and as a reagent. It is also a useful building block for the synthesis of other compounds. 1PHPP can be used to prepare complex compounds with versatile building blocks or scaffolds, which can serve as reaction components in organic syntheses. This compound has been shown to react with various functional groups.</p>Formula:C15H12N2OPurity:Min. 95%Color and Shape:PowderMolecular weight:236.27 g/molFmoc-Pro-Phe-OH
CAS:<p>Please enquire for more information about Fmoc-Pro-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H28N2O5Purity:Min. 95%Molecular weight:484.54 g/molFmoc-Ala-Ala-Pro-OH
CAS:<p>Fmoc-Ala-Ala-Pro-OH is a building block that is used in organic synthesis as a reaction component or reagent. It can be used to synthesize a wide range of complex compounds with speciality chemical and fine chemical applications. Fmoc-Ala-Ala-Pro-OH is also a versatile building block that can be used to synthesize various useful scaffolds, such as the Fmoc amino acid sequence, which has been shown to bind heparin. This compound has high purity and can be used in research and development.</p>Formula:C26H29N3O6Purity:Min. 95%Color and Shape:PowderMolecular weight:479.53 g/molZ-Asp(OtBu)-ONp
CAS:<p>Please enquire for more information about Z-Asp(OtBu)-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H24N2O8Purity:Min. 95%Molecular weight:444.43 g/molAMCA-Glu-Glu-Lys-Pro-Ile-Ser-Phe-Phe-Arg-Leu-Gly-Lys(biotinyl)-NH2
CAS:<p>Please enquire for more information about AMCA-Glu-Glu-Lys-Pro-Ile-Ser-Phe-Phe-Arg-Leu-Gly-Lys(biotinyl)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H131N21O22SPurity:Min. 95%Molecular weight:1,891.2 g/mol3-(2R,3S)-Phenylisoserine
CAS:<p>3-(2R,3S)-Phenylisoserine is a chiral enantiomer that can be used in organic synthesis. It is a reactive compound and has the ability to form amide bonds with other compounds. 3-(2R,3S)-Phenylisoserine is also able to react with nitro groups and form an oxime. It is not soluble in water but it is soluble in organic solvents like acetone or methanol. 3-(2R,3S)-Phenylisoserine can be synthesized by the enzymatic methods of benzyloxymethyl hydrazine and hydrochloric acid.</p>Formula:C9H11NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:181.19 g/molCaspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid)
CAS:<p>Caspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) is a peptide inhibitor of caspases. It blocks the activation of these proteases and their subsequent cleavage of substrates in the apoptotic pathway. This drug has potent inhibitory activity against caspases 3, 7, 8, 9, and 10. Caspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) specifically interacts with the active site and inhibits the enzyme by binding to an aspartic acid residue at position D197 in human caspase 3. Caspase 3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) is localized to mitochondria and binds to acetyldeviceine (acDEV), a substrate for caspases</p>Formula:C20H31N5O10Purity:Min. 95%Molecular weight:501.49 g/molMeOSuc-Ala-Ala-Pro-Ala-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone is a peptidyl substrate for the enzyme carboxypeptidase A. This substrate has a high specificity for carboxypeptidase A and does not bind to other enzymes such as carboxypeptidase B, D, or L. The hydrophobic nature of this substrate has been shown in both hamsters and macaques. MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone also shows cardiovascular effects in both animal models. It is possible that this effect is due to the proteolytic activity of the enzyme. More research needs to be done to identify the sequence of this peptide and how it may affect humans.</p>Formula:C20H31ClN4O7Purity:Min. 95%Molecular weight:474.94 g/molBoc-Gly-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Gly-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Tyr-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Tyr-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N6O3·2HClPurity:Min. 95%Molecular weight:409.31 g/molHIV (gp120) Fragment (308-331)
CAS:<p>HIV is a type of virus that causes AIDS. HIV infects the cells of the human immune system, destroying them and making the body vulnerable to infections from other types of viruses and bacteria. The gp120 protein is an envelope glycoprotein that mediates binding to the CD4 receptor on host T-helper cells and induces fusion of viral and cellular membranes. The gp120 protein has been studied using a variety of methods, including neutralizing antibody binding experiments, enzyme-linked immunosorbent assays (ELISA), Western blotting, peptide mapping, and density lipoprotein binding assays. This fragment contains residues 308-331 in a human immunodeficiency virus (HIV) type 1 gp120 protein.</p>Formula:C114H199N41O31Purity:Min. 95%Molecular weight:2,640.06 g/molZ-Gly-Leu-NH2
CAS:<p>Z-Gly-Leu-NH2 is a synthetic peptide that has been designed to mimic the amino acid sequence of casein. It is a metalloendopeptidase inhibitor and can be used in the synthesis of proteins. Z-Gly-Leu-NH2 inhibits the activity of subtilisin, which is a proteolytic enzyme. The inhibition of subtilisin by Z-Gly-Leu-NH2 prevents the hydrolysis of peptide bonds in protein substrates. This inhibition leads to an increase in molecular weight and molecular weight distribution, as well as an increase in the number of high molecular weight peaks on chromatograms. This peptide also has serine protease inhibitory activity and can be used as a synthetic substrate for kinetic studies.</p>Formula:C16H23N3O4Purity:Min. 95%Molecular weight:321.37 g/molEthyl 2-oxo-4-phenylbutyrate
CAS:<p>Ethyl 2-oxo-4-phenylbutyrate is a compound that belongs to the class of ester compounds. This molecule is found in cells grown in recombinant cultures and has been identified by its FTIR spectroscopy. Ethyl 2-oxo-4-phenylbutyrate inhibits the growth of candida glabrata by inhibiting an enzyme, which is involved in the conversion of glucose to acetoin. The mechanism for this inhibition is believed to be due to cinchonidine, which reacts with chloride ions. The chemical stability of ethyl 2-oxo-4-phenylbutyrate has been shown by its ability to withstand acidic pH and high concentrations of chloride ions without decomposing. Ethyl 2-oxo-4-phenylbutyrate also inhibits the synthesis of proteins and enzymes, although it does not inhibit DNA replication or transcription.</p>Formula:C12H14O3Purity:Min. 95%Molecular weight:206.24 g/molH-Asp-Asp-Asp-Asp-OH
CAS:<p>Please enquire for more information about H-Asp-Asp-Asp-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N4O13Purity:Min. 95%Molecular weight:478.37 g/molBz-Asn-Gly-Thr-NH2
CAS:<p>Please enquire for more information about Bz-Asn-Gly-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O6Purity:Min. 95%Molecular weight:393.39 g/molS-(1,2-Dicarboxyethyl)glutathione
CAS:<p>S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.</p>Formula:C14H21N3O10SPurity:Min. 95%Molecular weight:423.4 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH
CAS:<p>Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH is a molecule that can be used to generate an antigen against tumor necrosis factor alpha (TNFα). It has been shown to be able to bind TNFα and prevent it from binding to its receptors. This leads to a decrease in the production of cytokines, as well as a decrease in the activation of cytosolic guanylate cyclase. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH has also been shown to inhibit the proliferation of cancer cells by inhibiting extracellular Ca2+ influx and cytosolic Ca2+ ion concentrations.</p>Formula:C59H111N3O9SPurity:Min. 95%Molecular weight:1,038.59 g/molBoc-Glu-OFm
CAS:<p>Please enquire for more information about Boc-Glu-OFm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27NO6Purity:Min. 95%Molecular weight:425.47 g/mol6-Methoxy-2,3,4,9-tetrahydro-1H-β-carbolin-1-one
CAS:<p>6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carbolin-1-one is a β-carboline alkaloid that is structurally related to harmaline and tetrahydroharmine. It has been shown to have antidepressant activity in animals. 6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carbolin-1-one was analyzed by GC/MS and found to be present in the leaves of plants from the genus Tetraclinis. 6MHBC was also identified as a metabolite of diazepam in rat urine after administration of a single oral dose of 10 mg/kg diazepam. The observed β carboline metabolite was determined to be 6MHBC.</p>Formula:C12H12N2O2Purity:Min. 95%Molecular weight:216.24 g/molZ-Pro-Leu-Gly-OH
CAS:<p>Z-Pro-Leu-Gly-OH is a peptide that belongs to the class of amides, oxalate salts, and grignard reagents. It can be synthesized from the reaction between an oxalate salt and a grignard reagent. The synthesis of Z-Pro-Leu-Gly-OH is usually done by reacting an oxalate salt with a grignard reagent in presence of a ketone or ketomethylene.</p>Formula:C21H29N3O6Purity:Min. 95%Molecular weight:419.47 g/mol[4-(1-Cyano-1-methylethyl)phenyl]boronic acid
CAS:<p>Please enquire for more information about [4-(1-Cyano-1-methylethyl)phenyl]boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12BNO2Purity:Min. 95%Molecular weight:189.02 g/mol(Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H86N16O13Purity:Min. 95%Molecular weight:1,251.44 g/mol(1-Methyl-1H-pyrazol-4-yl)boronic acid
CAS:<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>Formula:C4H7BN2O2Purity:Min. 95%Molecular weight:125.92 g/molH-Asp(Leu-OH)-OH
CAS:<p>H-Asp(Leu-OH)-OH is a bioactive molecule that can induce apoptosis in cancer cells. Mechanistically, this compound induces apoptosis by increasing the amount of reactive oxygen species (ROS) and reducing mitochondrial membrane potential in cancer cells. The anti-cancer activity of H-Asp(Leu-OH)-OH has been shown to be dose dependent and it has been observed to cause vacuolization in kidney cells. Chemical compositions show that H-Asp(Leu-OH)-OH is composed of Aspartic acid, Leucine, and Hydroxyl groups.</p>Formula:C10H18N2O5Purity:Min. 95%Molecular weight:246.26 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS:<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.</p>Formula:C7H10N2O4•HBrPurity:Min. 95%Molecular weight:267.08 g/molFibronectin Fragment (1376-1380) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1376-1380) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H39N11O8Purity:Min. 95%Molecular weight:609.64 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13·C2HF3O2Purity:Min. 95%Molecular weight:1,310.34 g/molH-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N8O10Purity:Min. 95%Molecular weight:726.78 g/molH-Gly-Gly-His-Ala-OH
CAS:<p>H-Gly-Gly-His-Ala-OH is a peptide of four amino acids. It has been shown experimentally that the side chain of His is always oriented in the same direction, regardless of the conformation. The proton shift constants and vicinal coupling constants for Gly, Gly and Ala are constant, while His has a variable proton shift constant. The experimental parameters for the molecule have been rationalized by using conformational shifts to explain their variability. For example, the proton shift constants have been found to be dependent on the rotation about an axis perpendicular to the peptide backbone. H-Ala-Gly-Gly-His-OH is a pentapeptide with five amino acids that differs from HGGHAOH by having Ala instead of His at position 1. The vicinal coupling constants are different and so are other experimental parameters.</p>Formula:C13H20N6O5Purity:Min. 95%Molecular weight:340.34 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molFmoc-N-methyl-O-tert-butyl-L-tyrosine
CAS:<p>Fmoc-N-methyl-O-tert-butyl-L-tyrosine is a peptide that mimics the natural substrate serine protease. It has been used to study protein-protein interactions in proteases and their cleavage specificity. This peptide was designed as a peptidomimetic, which is an analog of a protein or peptide. The systematic synthesis of this molecule has been studied extensively and it has been shown that the maximum number of modifications occurs at the N terminus and the minimal number at the C terminus. The residue of this molecule is modified by proteolytic modification, which is a chemical modification that changes the amino acid sequence. Fmoc-N-methyl-O-tert-butyl-L-tyrosine has minimal quantified stability, which means that it can be quantified but not stable for long periods of time.</p>Formula:C29H31NO5Purity:Min. 95%Molecular weight:473.56 g/molH-D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2 (Disulfide bond between Cys2 and Pen7)
CAS:<p>H-D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2 is a neuropeptide that was found in the brain of an amphibian and has been shown to have antinociceptive properties. The peptide has been shown to bind to kappa opioid receptors and δ opioid receptors, which are both involved in pain regulation. H-D-Phe-Cys-Tyr-D-Trp-Orn (HDFYDT) has been shown to be effective in vivo, which may be due to its ability to increase striatal dopamine levels and decrease locomotor activity. HDFYDT also increases gamma aminobutyric acid levels in the brain, which may result in reduced anxiety. HDFYDT is synthesized from two amino acids: histidine and glutamine. This peptide is sensitive to proteolytic enzymes and can be degraded into smaller fragments such</p>Formula:C50H67N11O11S2Purity:Min. 95%Molecular weight:1,062.27 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H47FN4O15Purity:Min. 95%Molecular weight:878.85 g/molZ-Lys(Z)-Ser-OH
CAS:<p>Please enquire for more information about Z-Lys(Z)-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H31N3O8Purity:Min. 95%Molecular weight:501.53 g/molH-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Astressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molZ-D-Arg(Z)2-OH
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H32N4O8Purity:Min. 95%Molecular weight:576.6 g/molZ-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>Formula:C18H23N3O6Purity:Min. 95%Molecular weight:377.39 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/mol1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
CAS:<p>Please enquire for more information about 1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H76NO8PPurity:Min. 95%Molecular weight:718 g/molInsulin B (22-25)
CAS:<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N7O5Purity:Min. 95%Molecular weight:525.6 g/molH-Cys-Thr-Thr-His-Trp-Gly-Phe-Thr-Leu-Cys-OH (Disulfide bond)
CAS:<p>Disulfide bond is a protein that regulates muscle cell assembly and interactions. Disulfide bonds are formed by the oxidation of two cysteine molecules, which can be found in the extracellular matrix (ECM). The protein is an important regulator of metalloproteinases, which are enzymes that regulate ECM turnover. When disulfide bond lacks, it causes a deficiency in collagen production. Disulfide bond also has interactions with MMP-2, which plays a role in the regulation of arteriosclerosis and genetic disorders such as muscular dystrophy.</p>Formula:C52H71N13O14S2Purity:Min. 95%Molecular weight:1,166.33 g/mol2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol
CAS:<p>2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol is an impurity in hexane that is generated during the reaction of pyridine with acetonitrile. The impurity is removed by crystallizing it from methanol. 2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol has a high efficiency, and can be used to synthesize hexamethyldisiloxane. This product can be used as a metal catalyst for reactions involving alkali metals or metal halides. It can also be used as an alcohol solvent, but not hydrogenated.</p>Formula:C17H21N3OPurity:Min. 95%Color and Shape:White to off white powderMolecular weight:283.37 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/mol(Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H300N54O59S2Purity:Min. 95%Molecular weight:4,432.95 g/molZ-Gly-Ala-His-AMC
CAS:<p>Please enquire for more information about Z-Gly-Ala-His-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N6O7Purity:Min. 95%Molecular weight:574.58 g/molFmoc-Tyr-Ala-diazomethylketone
CAS:<p>Please enquire for more information about Fmoc-Tyr-Ala-diazomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H26N4O5Purity:Min. 95%Molecular weight:498.53 g/mol5-Iodo-2-methoxybenzyl alcohol
CAS:<p>5-Iodo-2-methoxybenzyl alcohol (5IMB) is a conjugate that inhibits tubulin polymerization and mitochondrial membrane integrity. It has significant inhibitory effects on colchicine-induced apoptosis in colon cancer cells, inducing apoptotic cell death by the activation of caspase 3 and annexin. 5IMB also has an inhibitory effect on mitochondria, leading to mitochondrial membrane depolarization and apoptotic cell death. This conjugate also induces the death of human cancer cells, specifically mcf-7, which are involved in tumour growth and metastasis. The mechanism of action for 5IMB is through its ability to induce mitochondrial membrane depolarization, leading to apoptotic cell death.</p>Formula:C8H9O2IPurity:Min. 95%Molecular weight:264.06 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS:<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H159N25O32S5·C2HF3O2Purity:Min. 95%Molecular weight:2,605.93 g/molH-D-Leu-bNA·HCl
CAS:<p>Please enquire for more information about H-D-Leu-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N2O·HClPurity:Min. 95%Molecular weight:292.8 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Formula:C129H230N36O29SPurity:Min. 95%Molecular weight:2,781.5 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS:<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H50N6O10Purity:Min. 95%Molecular weight:726.82 g/molOsteoblast Activating Peptide (human) trifluoroacetate salt
<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37SPurity:Min. 95%Molecular weight:2,795.14 g/molTyr-Bradykinin
CAS:<p>Bradykinin is a peptide with a variety of physiological effects. It is formed by the cleavage of kininogen by kallikrein, and it is involved in the regulation of vascular tone and blood pressure, as well as responses to pain and inflammation. Bradykinin stimulates the release of histamine from mast cells, which causes an inflammatory response. Bradykinin also has been shown to stimulate the release of leukotrienes, prostaglandins, and cytokines from human lung tissue. The interaction between bradykinin and its receptors has been studied extensively using in vitro assays. The conformational changes in this peptide have been characterized by spectroscopic studies such as nuclear magnetic resonance (NMR) and circular dichroism (CD). In addition, bradykinin can be detected using luminescence techniques such as chemiluminescence or bioluminescence. Studies have shown that micromolar concentrations of bradykinin</p>Formula:C59H82N16O13Purity:Min. 95%Molecular weight:1,223.38 g/molBoc-Glu(OBzl)-Ala-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Boc-Glu(OBzl)-Ala-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H47N7O9·HClPurity:Min. 95%Molecular weight:758.26 g/molZ-Thr(Bzl)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H21NO5·C12H23NPurity:Min. 95%Molecular weight:524.69 g/molBoc-Ser(Bzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ser(Bzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Uroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/mol(Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molN2-(2-Tricyclo[3.3.1.13,7]dec-1-ylacetyl)-D-arginyl-L-arginyl-L-prolyl-(4R)-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl- D-phenylalanyl-3-(2-thienyl)-L-alanyl-L-arginine
CAS:<p>Please enquire for more information about N2-(2-Tricyclo[3.3.1.13,7]dec-1-ylacetyl)-D-arginyl-L-arginyl-L-prolyl-(4R)-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl- D-phenylalanyl-3-(2-thienyl)-L-alanyl-L-arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H99N19O14S2Purity:Min. 95%Molecular weight:1,470.77 g/molBoc-D-Pro-Gly-OH
CAS:<p>Please enquire for more information about Boc-D-Pro-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N2O5Purity:Min. 95%Molecular weight:272.3 g/molH-Val-Lys-OH monoacetate salt
CAS:<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H23N3O3•C2H4O2Purity:Min. 95%Molecular weight:305.37 g/mol1-Boc-4-aminoindole
CAS:<p>Please enquire for more information about 1-Boc-4-aminoindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H16N2O2Purity:Min. 95%Molecular weight:232.28 g/molFor-Met-Val-OH
CAS:<p>For-Met-Val-OH is a synthetic molecule that has been shown to inhibit the growth of bacteria by binding to the ribosomal subunit, thereby inhibiting protein synthesis. This compound was synthesized in vitro and has been shown to be effective against single-stranded DNA. For-Met-Val-OH can also bind to the template strand of DNA and inhibit the synthesis of RNA. It binds to functional genes and inhibits their function in a similar manner as natural substrates. This inhibition may be due to inhibition of protein synthesis or other unknown mechanisms. The structure of For-Met-Val-OH is similar to hydroxamic acids, which are known for their antibacterial properties.</p>Formula:C11H20N2O4SPurity:Min. 95%Molecular weight:276.35 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS:<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>Formula:C106H172N32O32Purity:Min. 95%Molecular weight:2,406.7 g/molZ-Phe-Cit-AMC
CAS:<p>Z-Phe-Cit-AMC is a fluorescent substrate for the enzymes cysteine and peptide aminopeptidases. It has been synthesized by conjugating 7-amino-4-methylcoumarin with L-phenylalanine. The product is useful in assays to measure the activity of these enzymes, which are involved in protein digestion and wound healing. Z-Phe-Cit-AMC can be hydrolyzed by bromelain, ficin, or papain and it can be used as a substrate for enzyme reactions.</p>Formula:C33H35N5O7Purity:Min. 95%Molecular weight:613.66 g/molBoc-Arg(Tos)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Arg(Tos)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%([ring-D5]Phe6)-Somatostatin-14
<p>Please enquire for more information about ([ring-D5]Phe6)-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H99D5N18O19S2Purity:Min. 95%Molecular weight:1,642.91 g/molH-Lys-Ala-pNA·2 HCl
CAS:<p>Please enquire for more information about H-Lys-Ala-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N5O4·2HClPurity:Min. 95%Molecular weight:410.3 g/molH-β-(7-Methoxycoumarin-4-yl)-Ala-OH
CAS:<p>Please enquire for more information about H-beta-(7-Methoxycoumarin-4-yl)-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H13NO5Purity:Min. 95%Molecular weight:263.25 g/mol(D-Phe5,Cys6·11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide
CAS:<p>Please enquire for more information about (D-Phe5,Cys6·11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H67N11O10S2Purity:Min. 95%Molecular weight:1,046.27 g/molH-Gly-Pro-Gly-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Pro-Gly-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H16N4O3·HClPurity:Min. 95%Molecular weight:264.71 g/molNeuronostatin-13 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H112N20O17Purity:Min. 95%Molecular weight:1,445.71 g/molH-Gly-Gly-Pro-OH
CAS:<p>H-Gly-Gly-Pro-OH is a recombinant polypeptide with affinity for amino acids. It is a positionally defined sequence of amino acids that has been shown to bind to Alzheimer's disease (AD) amyloid peptides and inhibit the formation of beta amyloid fibrils. The N-terminal sequence of this polypeptide is immunogenic, which may be useful for generating antibodies against AD.</p>Formula:C9H15N3O4Purity:Min. 95%Molecular weight:229.23 g/molH-Asp-AMC
CAS:<p>Please enquire for more information about H-Asp-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H14N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:290.27 g/molAc-D-Lys-OH
CAS:<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>Formula:C8H16N2O3Purity:Min. 95%Molecular weight:188.22 g/molEndothelial-Monocyte-Activating Polypeptide II-Derived Peptide
CAS:<p>Please enquire for more information about Endothelial-Monocyte-Activating Polypeptide II-Derived Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H142N26O22Purity:Min. 95%Molecular weight:1,832.16 g/molH-Ala-Tyr-Ala-OH
CAS:<p>H-Ala-Tyr-Ala-OH is a peptidomimetic that has shown promising anti-inflammatory and anticancer properties. It has been found to inhibit the proliferation of human cancer cells and to suppress the growth of human tumor xenografts in mice. It also has shown an ability to cross the blood brain barrier, which may be due to its high lipophilicity. H-Ala-Tyr-Ala-OH inhibits the production of inflammatory cytokines, such as TNFα, IL1β, IL6, and IL8, by inhibiting NFκB activation in immune cells. This inhibition leads to decreased inflammation and fibrosis in various tissues. H-Ala-Tyr-Ala-OH is also active against bacteria and viruses, which may be due to its low molecular weight.</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/molH-Val-Pro-OtBu·HCl
CAS:<p>Please enquire for more information about H-Val-Pro-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N2O3·HClPurity:Min. 95%Molecular weight:306.83 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molH-Gly-Gly-Glu-OH
CAS:<p>H-Gly-Gly-Glu-OH is a hydrolysate of the proteasome peptide. It has reversed-phase and liquid chromatography properties, which make it a useful biochemical tool for the analysis of proteins. The carboxylate group at the end of H-Gly-Gly-Glu-OH can be used as an isopeptide to determine the sequence of peptides that are synthesized by a prokaryotic or eukaryotic cell. H-Gly-Gly-Glu-OH can also be used to cleave ligation products in order to analyse them.</p>Formula:C9H15N3O6Purity:Min. 95%Molecular weight:261.23 g/mol4-Bromophenylalanine
CAS:<p>4-Bromophenylalanine is a chemical compound that can be used as a spectroscopic probe to study the dynamics of protein synthesis. It is derived from 4-bromobenzaldehyde, which is oxidized by hydrogen peroxide in the presence of cytochrome P450 reductase and NADPH, yielding 4-bromophenylalanine. This compound has been shown to inhibit protein synthesis by binding reversibly to the synthetase during its synthetic cycle. The binding of 4-bromophenylalanine inhibits the synthesis of peptides with a C-terminal amide group. This inhibition leads to a decrease in the amount of functional groups present in proteins and an increase in the amount of buffers. These effects have been demonstrated through modelling studies using both model organisms and buffer solutions.</p>Formula:C9H10BrNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:244.09 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H222N38O49Purity:Min. 95%Molecular weight:3,161.43 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/molZ-Trp-Val-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about Z-Trp-Val-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N3O5•CF3CO2HPurity:Min. 95%Molecular weight:437.49 g/molH-Ser-Leu-OH
CAS:<p>H-Ser-Leu-OH is a methylvaleric acid that is found in biological tissue and has been studied for its potential use as a pharmacological treatment. It has been shown to have anti-inflammatory effects, which may be due to its inhibition of prostaglandin synthesis. H-Ser-Leu-OH also inhibits the activity of divalent metal ions, such as magnesium and zinc, by binding to their chelating groups. This binding prevents the formation of an enzyme cell wall synthesis complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. H-Ser-Leu-OH has also shown potential as an analytical method for cancer detection. It can be used to detect carcinogenesis by detecting changes in DNA methylation patterns at the promoter region of tumor suppressor genes (e.g., RASSF1A).</p>Formula:C9H18N2O4Purity:Min. 95%Molecular weight:218.25 g/molAc-Leu-Glu-His-Asp-chloromethylketone
CAS:<p>Ac-Leu-Glu-His-Asp-chloromethylketone is a creatine kinase inhibitor that prevents the conversion of ATP to ADP. It inhibits mitochondrial pathways, leading to apoptotic and proapoptotic effects. Ac-Leu-Glu-His-Asp-chloromethylketone also has a kinetic effect on cells, where it causes necrotic cell death. This compound can cause proteolytic activity, which leads to the activation of caspase 9 and matrix metalloproteinases. Ac-Leu-Glu-His-Asp chloromethylketone has been shown to have antiinflammatory properties in cellular assays, as well as an ability to inhibit the synthesis of cellular proteins.</p>Formula:C24H35ClN6O9Purity:Min. 95%Molecular weight:587.02 g/molMAGE-1 Antigen (161-169) (human) acetate salt
CAS:<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>Formula:C41H57N11O17Purity:Min. 95%Molecular weight:975.96 g/molSubstance P (2-11)
CAS:<p>Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a peptide that is the product of proteolytic cleavage of substance P. It binds to the neurokinin receptor and induces degranulation in mast cells and sensory neurons. It has been used as a diagnostic tool for mast cell degranulation. Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe has also been used to assess lung function in anesthetized animals, circulations in muscle, and changes in perfusion during surgical procedures.</p>Formula:C57H86N14O12SPurity:Min. 95%Molecular weight:1,191.45 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Formula:C50H80N14O14SPurity:Min. 95%Molecular weight:1,133.32 g/mol1-(3-Chloro-4-methoxyphenyl)acetone
CAS:<p>1-(3-Chloro-4-methoxyphenyl)acetone is a white solid with a melting point of 60-61°C. It is a versatile building block that can be used in the synthesis of complex compounds and as a reaction component for the preparation of speciality chemicals. 1-(3-Chloro-4-methoxyphenyl)acetone has been studied extensively as an intermediate for the synthesis of pharmaceuticals, including acetaminophen and amoxicillin. This compound also has uses in research laboratories and as a reagent in organic synthesis.</p>Formula:C10H11ClO2Purity:Min. 95%Molecular weight:198.65 g/molAtrial Natriuretic Factor (1-28) (human) hydrochloride salt
CAS:Controlled Product<p>Please enquire for more information about Atrial Natriuretic Factor (1-28) (human) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H203N45O39S3Purity:Min. 95%Molecular weight:3,080.45 g/molMyelin Basic Protein (83-99) (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H143N25O24Purity:Min. 95%Molecular weight:1,995.28 g/molAtrial Natriuretic Factor (5-27) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H154N34O32S3Purity:Min. 95%Molecular weight:2,404.67 g/molBoc-Phe-Phe-OH
CAS:<p>Boc-Phe-Phe-OH is a linker that is used to create homologues. It has been shown to be able to form supramolecular structures and encapsulate biomolecules, such as amino acids. The ester linkage of Boc-Phe-Phe-OH can be modified by the addition of a carboxylic acid, which can lead to changes in its fluorescence and magnetic properties. Boc-Phe-Phe-OH is primarily used as an intermediate for fluorescent probes or other molecules.</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molH-Gly-b-Ala-b-Ala-OH
CAS:<p>Please enquire for more information about H-Gly-b-Ala-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molLauroyl lysine
CAS:<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>Formula:C18H36N2O3Purity:99.18%Color and Shape:White To Off-White Solid With Characteristic Faint OdorMolecular weight:328.49Biotinyl-MCH (salmon) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H153N29O26S5Purity:Min. 95%Molecular weight:2,325.78 g/molFmoc-3-(2-naphthyl)-L-alanine
CAS:<p>Fmoc-3-(2-naphthyl)-L-alanine is a supramolecular compound that functions as an inhibitor of prostate cancer cells. It inhibits the uptake of metal chelates by prostate cancer cells and stabilizes them, which may lead to a diagnostic and therapeutic agent for prostate cancer. Fmoc-3-(2-naphthyl)-L-alanine has also been shown to inhibit the growth of human serum prostate cancer cells in vitro and in vivo models. This molecule is a bifunctional compound that can be used as both an antigen and a surrogate for cytosolic prostate specific antigen (PSA) levels. Fmoc-3-(2-naphthyl)-L-alanine has been shown to bind to the PSA protein, which is normally found on the surface of prostate epithelial cells. This binding prevents it from being released into the blood circulation, where it would otherwise be measured by a PSA test</p>Formula:C28H23NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:437.49 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molL-Threonine derivative-1
CAS:<p>L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.</p>Formula:C13H15NO6Purity:97.03% - 98.91%Color and Shape:SolidMolecular weight:281.26(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/mol(p-Amino-Phe6)-Angiotensin II
CAS:<p>Please enquire for more information about (p-Amino-Phe6)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H74N12O12Purity:Min. 95%Molecular weight:1,071.23 g/mol(Tyr65,Phe67)-C5a (65-74) (human)
CAS:<p>Please enquire for more information about (Tyr65,Phe67)-C5a (65-74) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H85N15O16SPurity:Min. 95%Molecular weight:1,244.42 g/molHexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt
<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H250N44O43SPurity:Min. 95%Molecular weight:3,425.96 g/molNeurotensin (1-8) Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-OH
CAS:<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>Formula:C46H71N13O14Purity:Min. 95%Molecular weight:1,030.14 g/molBoc-Ser(Ala-Fmoc)-OH
CAS:<p>Boc-Ser(Ala-Fmoc)-OH is a synthetic amino acid that is used in peptide synthesis. It is typically prepared by the condensation of Serine with diethyl Fmoc-amino acid and hydrochloric acid. This molecule has an efficient epimerization process, which allows for the synthesis of the other enantiomer, L-Ser(Ala-Fmoc)-OH. The synthetic method for Boc-Ser(Ala-Fmoc)-OH can be used to synthesize peptides from amino acids.</p>Formula:C26H30N2O8Purity:Min. 95%Molecular weight:498.53 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molRetrocyclin-1 trifluoroacetate salt
CAS:<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/molBoc-Arg-SBzl·HCl
CAS:<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molAc-Ser-Gly-OH
CAS:<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molChloroac-DL-Phe-OH
CAS:<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>Formula:C11H12ClNO3Purity:Min. 95%Molecular weight:241.67 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H86N18O12Purity:Min. 95%Molecular weight:1,239.43 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molAngiogenin (108-122)
CAS:<p>Please enquire for more information about Angiogenin (108-122) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H125N25O23Purity:Min. 95%Molecular weight:1,780.98 g/molAcetyl-Hirudin (55-65) (desulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH
CAS:<p>Please enquire for more information about Acetyl-Hirudin (55-65) (desulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H92N12O25Purity:Min. 95%Molecular weight:1,453.5 g/molZ-Trp-Leu-OH
CAS:<p>Please enquire for more information about Z-Trp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O5Purity:Min. 95%Molecular weight:451.51 g/molBoc-Pro-Pro-Pro-Pro-OH
CAS:<p>Boc-Pro-Pro-Pro-Pro-OH is a synthetic peptide. It has been shown to have high specificity and is useful in the diagnosis of diseases that are caused by abnormal extracellular glutamic acid, hydroxyproline, or ion-exchange. Boc-Pro-Pro-Pro-Pro-OH has been used as a model for other peptides and has been shown to have acidic properties. The structure is dodecyl peptidic with a residue of -N(CH2)3-.</p>Formula:C25H38N4O7Purity:Min. 95%Molecular weight:506.59 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H216N42O45Purity:Min. 95%Molecular weight:3,183.45 g/mol5-Phenylisoxazole-3-carboxylic acid
CAS:<p>5-Phenylisoxazole-3-carboxylic acid is a phenoxy compound that has been shown to inhibit the growth of tuberculosis bacteria. This drug binds to the postsynaptic potential in the cell membrane and inhibits the effector proteins from interacting with the receptor, preventing neurotransmitter release. The molecular modeling study showed that 5-Phenylisoxazole-3-carboxylic acid interacts with ethyl esters and rifampin, which inhibits xanthine oxidase. Xanthine oxidase inhibitors are used as a treatment for gout and hyperuricemia. 5-Phenylisoxazole-3-carboxylic acid also has fluorimetric properties, which can be used to measure its concentration in biological samples such as urine or plasma. Nitro groups in this drug make it susceptible to oxidation by nitric oxide, which can be monitored using nmr spectra.</p>Formula:C10H7NO3Purity:Min. 95%Molecular weight:189.17 g/molH-Asp-Gly-OH
CAS:<p>H-Asp-Gly-OH is a peptide hormone that belongs to the group of hydroxylated aspartic acid. This peptide hormone has been shown to be a lymphocyte transformation factor in vitro and stimulates the production of collagen and other proteins. It has also been shown to have anticarcinogenic effects on bone cancer cells, which may be due to its ability to induce apoptosis. H-Asp-Gly-OH has a neutral pH and forms stable complexes with metal ions, such as copper and zinc, which are important for a variety of biological functions.</p>Formula:C6H10N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:190.15 g/molH-Thr-Val-OH
CAS:<p>The peptidomimetic H-Thr-Val-OH is a synthetic molecule that is hydrophobic. It has been shown to activate epidermal growth factor (EGF) through the transduction of a signal from outside the cell to inside the cell. This activation of EGF leads to increased levels of other molecules, such as cytosolic amide and hydrogen bond, which are important for cell growth. The amino acid sequence of H-Thr-Val-OH resembles that of EGF, allowing it to bind to the same receptor site on cells. This binding activates signalling pathways that lead to increased levels of proteins involved in cell proliferation, migration, and differentiation.</p>Formula:C9H18N2O4Purity:Min. 95%Molecular weight:218.25 g/molBiotinyl-Neuromedin S (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H279N55O46SPurity:Min. 95%Molecular weight:4,017.58 g/molH-Glu-Glu-bNA
CAS:<p>H-Glu-Glu-bNA is a dipeptide with the amino acid sequence H-Glu-Glu. It has a carboxy group, which can react with 2-naphthylamine to form a chromogenic product. This peptide also contains an amine group that can be reacted with l-glutamyl-l-glutamic acid to form a carboxylic acid. The c-terminal of this peptide can react with an amino group from another dipeptide to form a condensation product.</p>Formula:C20H23N3O6Purity:Min. 95%Molecular weight:401.41 g/molN-Methyl-N-((3R,4R)-4-methylpiperidin-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
CAS:<p>Intermediate in the synthesis of tofacitinib</p>Formula:C13H19N5Purity:Min. 95%Molecular weight:245.32 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O9S2Purity:Min. 95%Molecular weight:1,177.83 g/mol(3-Methyl-2-nitro-3H-imidazol-4-yl)methanol
CAS:<p>3-Methyl-2-nitro-3H-imidazol-4-yl)methanol is a fluorescent probe that can be used to detect hypoxic tumor cells. It has been shown to selectively react with the methylethyl group in Trichomonas vaginalis. 3-Methyl-2-nitro-3H-imidazol-4-yl)methanol is bioreductive and can be activated by nitro groups in proteins, which are found in the active site of enzymes such as bacterial dna gyrase. This probe has been shown to bind to the sn38 position of bacterial DNA, but not mammalian DNA.</p>Formula:C5H7N3O3Purity:Min. 95%Molecular weight:157.13 g/molH-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH
CAS:<p>H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH is a synthetic peptide that has been shown to have a homologous sequence with the amino acid sequence of a primary tumor. This peptide has strong binding affinity to tyrosine kinase, which is an enzyme involved in cellular signal transduction. H-Arg-Arg-Leu-Ile-Glu-Asp-Asn Glu Tyr Thr Ala Arg Gly OH has been shown to inhibit the growth of tumors and can be used as an analytical method for identifying carcinoma cells in vitro. HAAGLTEIGDATASNTTAHARGLTRALAGRGGYOH is also a potential drug for cardiovascular diseases, as it can be taken up intracellularly and may inhibit the proliferation of vascular smooth muscle cells.</p>Formula:C66H109N23O23Purity:Min. 95%Molecular weight:1,592.71 g/molH-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Pro-Ala-OH is a fluorescent amino acid residue that can be used to study the structures of proteins. This amino acid is derived from histidine, and its fluorescence intensity increases when it binds to tryptophan residues near the active site of an enzyme. H-Ala-Pro-Ala-OH has been used for the structural analysis of mutant enzymes that have been engineered to show differences in substrate binding sites. This molecule also has a fluorogenic substrate, which can be used as a replacement for traditional substrates in order to highlight specific regions of a protein or enzyme. The quantum theory was used to calculate the x-ray diffraction data, which were then analyzed using software programs such as MOLMOL and XPLOR. These datasets were then used to create molecular models of H-Ala-Pro-Ala-OH.</p>Formula:C11H19N3O4Purity:Min. 95%Molecular weight:257.29 g/molBoc-Ala-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ala-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%pTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H314N58O53S2Purity:Min. 95%Molecular weight:4,371.06 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/molZ-Tyr-Val-Ala-Asp-chloromethylketone
CAS:<p>Z-Tyr-Val-Ala-Asp-chloromethylketone is a fluorescent probe that can be used for the detection of phosphatidic acid. It is also an apoptosis inducer, which means that it promotes cell death. Z-Tyr-Val-Ala-Asp-chloromethylketone induces apoptosis by binding to the kinases and causing their activation, leading to phosphatidic acid production. This process is activated by the presence of ethylene, which binds to Z-Tyr-Val-Ala-Asp chloromethylketone and stabilizes its structure.</p>Formula:C30H37ClN4O9Purity:Min. 95%Molecular weight:633.09 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molN-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide
CAS:<p>N-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide is a fine chemical that can be used as a reagent or intermediate. It is a versatile building block that can be used in the production of useful scaffolds or useful intermediates. This compound has been shown to react with many different types of chemicals, including alcohols and amines. N-Methyl-4-oxo-4,5-dihydropyridine-3-carboxamide can also be used as a reaction component in the synthesis of diverse compounds.</p>Formula:C7H8N2O2Purity:Min. 95%Color and Shape:White to grey solid.Molecular weight:152.15 g/molH-Arg-Ser-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N5O4Purity:Min. 95%Molecular weight:261.28 g/moltrans-4-Hydroxy-D-proline hydrochloride
CAS:<p>Please enquire for more information about trans-4-Hydroxy-D-proline hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H10ClNO3Purity:Min. 95%Molecular weight:167.59 g/molH-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Bromo-6-methylpyridine-3-carboxaldehyde
CAS:<p>2-Bromo-6-methylpyridine-3-carboxaldehyde (BMPCA) is a pharmacological agent that belongs to the group of antagonists. It has been shown to be a potent antagonist at the NMDA receptor and may be used for treating neuropathic pain. BMPCA also has been shown to have competitive inhibition at the naphthyridine receptor, which may allow it to act as an antagonist or an agonist depending on its binding site. The regioisomeric analogs of BMPCA are 2-(2,5-dichloropyridyl)-6-methylpyridine-3-carboxaldehyde and 2-(2,5-dimethylpyridyl)-6-methylpyridine-3-carboxaldehyde. These analogs have been shown to inhibit the growth of tumor cells in vitro and in vivo.</p>Formula:C7H6BrNOPurity:Min. 95%Molecular weight:200.03 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molBoc-Ala-D-Glu(OBzl)-NH2
CAS:<p>Please enquire for more information about Boc-Ala-D-Glu(OBzl)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H29N3O6Purity:Min. 95%Molecular weight:407.46 g/molBoc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS:<p>Please enquire for more information about Boc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N4O4Purity:Min. 95%Molecular weight:344.45 g/mol(R)-1-Boc-3-Aminopyrrolidine
CAS:<p>(R)-1-Boc-3-Aminopyrrolidine is a small molecule that inhibits 3-kinase. It has been shown to bind to the ATP binding site of PI3Kδ and inhibit its activity. This results in the inhibition of phosphoinositide production, which leads to decreased cell proliferation and survival. (R)-1-Boc-3-Aminopyrrolidine has also been shown to have selectivity for isoform α over β, γ, and δ. The drug binds specifically to the ATP binding site on PI3Kδ, but does not disrupt other interactions such as hydrogen bonding or pi stacking interactions with residues in the vicinity of the ATP binding site. The IC50 values for (R)-1-Boc-3-Aminopyrrolidine were determined using siRNA knockdown experiments against human isoform α PI3Kδ.</p>Formula:C9H18N2O2Purity:Min. 95%Molecular weight:186.25 g/molH-Leu-His-OH
CAS:<p>H-Leu-His-OH is a peptide that has been shown to have ovarian activity. It binds to the epidermal growth factor receptor and inhibits the function of this receptor, thereby inhibiting cellular proliferation. H-Leu-His-OH has also been shown to inhibit follicular growth in mice, which may be due to its ability to inhibit follicle stimulating hormone (FSH) production. This peptide also has a potential use for cancer treatment when administered with estradiol benzoate. In addition, it has been shown that H-Leu-His-OH can be used as an antigen in animals and humans for the development of an anti-idiotypic vaccine against autoimmune diseases such as Graves' disease. H-Leu-His-OH is active at physiological levels and clinical relevance has not yet been determined.</p>Formula:C12H20N4O3Purity:Min. 95%Molecular weight:268.31 g/molH-D-Met(O2)-OH
CAS:<p>H-D-Met(O2)-OH is an amino acid that is naturally occurring in the human body. It can be found in dietary sources such as milk, eggs, and meat. This amino acid is a building block for proteins and also has a number of metabolic pathways. H-D-Met(O2)-OH isomerizes to form D-Met(O2)-OH and L-Met(O2)-OH through enzymatic reactions. These isomers have different biological effects, with L-Met(O2)-OH being more potent than D-Met(O2)-OH. The enzyme that catalyzes this reaction is called synthetase. H-D-Met(O2)-OH can be used as a supplement to increase muscle mass or as a treatment for gluconeogenesis disorders such as diabetes mellitus type 2.</p>Formula:C5H11NO4SPurity:Min. 95%Molecular weight:181.21 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/molFITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I)
CAS:<p>Please enquire for more information about FITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H67N11O20SPurity:Min. 95%Molecular weight:1,318.32 g/molN-((RS)-2-Hydroxy-propyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-((RS)-2-Hydroxy-propyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H33N3O3Purity:Min. 95%Molecular weight:363.49 g/mol(D-Lys3)-GHRP-6
CAS:<p>D-Lys3-GHRP-6 is a synthetic peptide that has been shown to stimulate cellular proliferation and inhibit apoptosis in cell culture. D-Lys3-GHRP-6 binds to the ghrelin receptor, which is found on cells in the stomach and pancreas, as well as in the brain. This binding stimulates the release of cytosolic calcium and enhances protein synthesis. D-Lys3-GHRP-6 also stimulates growth factor production and increases body fat mass in animals.</p>Formula:C49H63N13O6Purity:Min. 95%Molecular weight:930.11 g/molIL-8 Inhibitor
CAS:<p>IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.</p>Formula:C45H66N18O7SPurity:Min. 95%Molecular weight:1,003.19 g/molAcetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH
CAS:<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N17O15Purity:Min. 95%Molecular weight:1,338.51 g/mol1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole
CAS:<p>1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole is an organic compound that is used in the synthesis of carboxylic acid derivatives. It is a synthetic intermediate, which can be converted to other compounds by intramolecular hydrogen bonding. The efficiency of this method has been shown through a number of experiments. In nature, 1-methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole may be found as a hydrogen bond donor.</p>Formula:C7H5Cl3N2O3Purity:Min. 95%Molecular weight:271.48 g/molH-Trp-Asp-OH trifluoroacetic acid
CAS:<p>H-Trp-Asp-OH trifluoroacetic acid is a protein that is localized in the kinase domain of the gene product. It has been shown to activate leishmania and human serum regulatory proteins. H-Trp-Asp-OH trifluoroacetic acid binds to guanine nucleotide binding proteins in the nuclear DNA, which may play a role in mitotic checkpoint control. This protein has also been shown to have basic properties and may be involved in plant metabolism.</p>Formula:C17H18N3O7F3Purity:Min. 95%Molecular weight:319.31 g/molRanamargarin
CAS:<p>Ranamargarin H-Asp-Asp-Ala-Ser-Asp-Arg-Ala-Lys-Lys-Phe-Tyr-Gly-Leu-Met-NH2 is a compound that has been shown to bind to the dopamine receptor in rats. It has been shown to have low potency and is not active in clinical trials. Ranamargarin H-Asp-Asp-Ala-Ser--Asp--Arg--Ala--Lys--Lys--Phe--Tyr--Gly--Leu---Met---NH2 has also been shown to inhibit the production of dopamine in animals and humans, with a maximal response at concentrations of 10 nM. The biological properties of this compound are still being researched, but it appears that it can be used as a lead for developing new drugs for treating Parkinson's disease.</p>Formula:C70H110N20O22SPurity:Min. 95%Molecular weight:1,615.81 g/mol(Des-Tyr1)-Leu-Enkephalin
CAS:<p>Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH is a synthetic opioid peptide that acts as a neuroprotective agent and has been shown to enhance the expression of nerve growth factor. It also has immunomodulatory effects by interacting with opioid receptors and regulating the production of inflammatory cytokines. Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH binds to opioid receptors in the central nervous system, thereby triggering a response that leads to pain relief and suppression of cough reflexes. This peptide has been shown to be effective in clinical trials for patients with neuropathic pain or postoperative ileus. It also shows promise as an analgesic for cancer patients with chronic pain, although this use is still experimental.</p>Formula:C19H28N4O5Purity:Min. 95%Molecular weight:392.45 g/molMet-Enkephalin-Arg-Phe
CAS:<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>Formula:C42H56N10O9SPurity:Min. 95%Molecular weight:877.02 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molAc-Leu-Val-Lys-aldehyde
CAS:<p>Please enquire for more information about Ac-Leu-Val-Lys-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H36N4O4Purity:Min. 95%Molecular weight:384.51 g/molH-D-Phe-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/mol1-Fluoro-3-phenylpropan-2-amine
CAS:Controlled Product<p>Please enquire for more information about 1-Fluoro-3-phenylpropan-2-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H12FNPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:153.2 g/molH-Asp-Ala-OH
CAS:<p>Adriamycin is an anticancer drug that is a structural analogue of aspartic acid. It can be synthesized in a solid-phase synthesis using a polymeric resin with an acidic functional group, such as H-Asp-Ala-OH. Adriamycin inhibits the production of inflammatory cytokines and prostaglandins, which are involved in the development of inflammatory diseases. Adriamycin has been shown to have anti-inflammatory effects on human serum and to inhibit the production of proteins important for tumor cell proliferation. Adriamycin also has anti-inflammatory properties due to its ability to bind with hydrogen bonds to acidic residues on proteins.<br>END></p>Formula:C7H12N2O5Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:204.18 g/molFmoc-Pro-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Pro-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Big Endothelin-1 fragment (22-38) (human)
CAS:<p>Please enquire for more information about Big Endothelin-1 fragment (22-38) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H125N23O25Purity:Min. 95%Molecular weight:1,808.99 g/molAbz-Ala-Gly-Leu-Ala-p-nitrobenzylamide
CAS:<p>Benzamidine is a benzamidase inhibitor that competitively binds to bacterial enzymes such as metalloendopeptidases and matrix metalloproteinases. It inhibits the degradation of collagen, resulting in a higher concentration of soluble extract. This drug also has an effect on spermatozoa, which may be due to its ability to inhibit bacterial enzymes that are involved with uptake and preload. Benzamidine has been shown to have a pH optimum of 8-9 and is most active at this pH range.</p>Formula:C28H37N7O7Purity:Min. 95%Molecular weight:583.64 g/mol(Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H68N10O12S2Purity:Min. 95%Molecular weight:1,089.29 g/mol3-Hydroxy-4-methyl-2-nitro-benzoic acid
CAS:<p>3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.</p>Purity:Min. 95%H-Met-Met-OH
CAS:<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>Formula:C10H20N2O3S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:280.41 g/mol(R)-Omeprazole
CAS:<p>Omeprazole is a proton pump inhibitor that inhibits gastric acid secretion by binding to the H+/K+ ATPase enzyme in the secretory canaliculi of the parietal cells. Omeprazole has been shown to have a protective effect in animal models against infection with Salmonella enterica serovar Typhimurium, and also protects against ulcers caused by Helicobacter pylori infection. Omeprazole is used as an adjunct treatment for patients with non-infectious gastroesophageal reflux disease (GERD) or active duodenal ulcers. It has also been used for the prevention of stress-related mucosal damage in critically ill patients, although it is not approved for this use. Omeprazole can be administered orally or by injection. When administered orally, omeprazole may cause gastrointestinal side effects such as nausea, abdominal pain, and diarrhea. Omeprazole can interact with other drugs such</p>Formula:C17H19N3O3SPurity:Min. 95%Color and Shape:Off-White PowderMolecular weight:345.42 g/molAcetyl-Amylin (8-37) (mouse, rat)
CAS:<p>Please enquire for more information about Acetyl-Amylin (8-37) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O44Purity:Min. 95%Molecular weight:3,242.6 g/molHistogranin
CAS:<p>Histogranin H is a glycoprotein that is secreted by gland cells. Histogranin H has been shown to have pharmacological effects on locomotor activity and pain in animal models. This protein has also been shown to inhibit cancer growth in vitro and in vivo. In addition, it has a protective effect on the central nervous system, which may be due to its ability to increase the expression of brain-derived neurotrophic factor (BDNF). It also inhibits the proliferation of glioma cells, which are cancerous tumors that originate from glial cells in the brain. Histogranin H binds to histone proteins and glutamate receptors, which leads to an antinociceptive effect when injected into rats. The antinociceptive effect of this protein is attenuated by trypsin treatment. Histogranin H has also been shown to have an analgesic effect when injected into rats with chronic pain models.</p>Formula:C78H119N21O21SPurity:Min. 95%Molecular weight:1,718.97 g/molZ-N-Me-Ser(tBu)-OH·DCHA
CAS:<p>Please enquire for more information about Z-N-Me-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H23NO5·C12H23NPurity:Min. 95%Molecular weight:490.68 g/mol(1,10-Phenanthroline)tris[4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedionato]europium(III)
CAS:<p>(1,10-Phenanthroline)tris[4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedionato]europium(III) is a luminescent europium complex that is used in the development of microcapsules for fluorescence microscopy. The (1,10-phenanthroline) ligand is a chelate molecule that can be exchanged with other ligands to change the optical properties of the complex. The fluorescence microscope detects the emitted light at 488 nm and 514 nm wavelengths. The luminescent europium complex emits light when it binds to an organic molecule such as vinyl alcohol or water vapor. Ternary complexes are formed between the europium ion and two different ligands. Optical properties depend on the type of ligands present in these ternary complexes. This product has been shown to have chemical structures that are similar to those</p>Purity:Min. 95%CART (55-76) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (55-76) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H166N26O33S3Purity:Min. 95%Molecular weight:2,440.82 g/molActivated Protein C (390-404) (human)
CAS:<p>Please enquire for more information about Activated Protein C (390-404) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H130N22O23Purity:Min. 95%Molecular weight:1,900.14 g/molH-Gly-Arg-Gly-Glu-Ser-Pro-OH
CAS:<p>H-Gly-Arg-Gly-Glu-Ser-Pro-OH is a peptide fragment of collagen that has been used in research to study the effects of this protein on fibrosis, bowel disease, and autoimmune diseases. It has also been found to be able to activate stem cells and is being studied for its application as a cell factor. This peptide fragment inhibits the growth of Candida glabrata by stimulating the production of growth factors such as β1 and colony stimulating factor. It also stimulates the production of integrin receptors, which are important for cell adhesion. H-Gly-Arg-Gly-Glu-Ser-Pro-OH has also been shown to have an antiviral effect in vivo models.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/mol(Deamino-Cys1,Val4,D-Arg8)-Vasopressin
CAS:<p>Vasopressin 3-mercaptopropionyl-Tyr-Phe-Val-Asn-Cys-Pro-D-Arg-Gly-NH2 is a peptide hormone that is involved in the regulation of water balance and blood pressure. It is a vasoconstrictor and has been shown to have an inhibitory effect on cellular targets such as soluble guanylate cyclase, which are involved in the synthesis of cGMP. Vasopressin 3-mercaptopropionyl-Tyr-Phe-Val-Asn-Cys Pro D Arg Gly NH2 also binds to the oxytocin receptor, which may be responsible for its vasodilatory effect.</p>Formula:C46H65N13O11S2Purity:Min. 95%Molecular weight:1,040.22 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H278N54O55Purity:Min. 95%Molecular weight:4,090.47 g/molZ-Trp-NH2
CAS:<p>Please enquire for more information about Z-Trp-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H19N3O3Purity:Min. 95%Molecular weight:337.37 g/molBoc-Val-Arg-AMC•HCl
CAS:<p>Please enquire for more information about Boc-Val-Arg-AMC•HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H38N6O6•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:567.08 g/molHCV NS4A Protein (22-34) (H strain)
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-34) (H strain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H109N17O15SPurity:Min. 95%Molecular weight:1,328.67 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H179N35O28SPurity:Min. 95%Molecular weight:2,591.99 g/mol1-Methyl-4-nitro-1H-pyrazole-3-carboxamide
CAS:<p>Please enquire for more information about 1-Methyl-4-nitro-1H-pyrazole-3-carboxamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%5-FAM-Woodtide trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H133N21O26SPurity:Min. 95%Molecular weight:1,945.2 g/mol

