
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,436 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38216 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Tyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C61H83N15O10Purity:Min. 95%Molecular weight:1,186.41 g/molBoc-Asp(OBzl)-chloromethylketone
CAS:<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>Formula:C17H22ClNO5Purity:Min. 95%Molecular weight:355.81 g/molHCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H116N20O17Purity:Min. 95%Molecular weight:1,425.72 g/molZ-Lys(Z)-ONp
CAS:<p>Z-Lys(Z)-ONp is an intermediate in the synthesis of lysergic acid diethylamide (LSD). It is a hypotensive agent that has analgesic properties. Z-Lys(Z)-ONp has been patented for use as a hypotensive agent, although it has not yet been approved for this use.</p>Formula:C28H29N3O8Purity:Min. 95%Molecular weight:535.55 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/molSuc-Ala-Ile-Pro-Phe-pNA
CAS:<p>Cyclosporine is a cyclic peptide that is used as an immunosuppressive drug. It binds to the cytosolic protein phosphatase, preventing its activation. Cyclosporine also binds to other proteins in the cell, such as casein kinase II and cyclophilin, leading to changes in cellular function. It has been shown to inhibit the production of cytokines and other inflammatory mediators by inhibiting tyrosine kinase activity. Cyclosporine is metabolized into FK506, which has a similar structure but greater potency than cyclosporine. The mechanism of action for FK506 is not fully understood but it appears to be related to its ability to bind to tyrosine kinases and inhibit their activity.</p>Formula:C33H42N6O9Purity:Min. 95%Molecular weight:666.72 g/mol1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt)
CAS:<p>1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:(C2H4O)nC44H87N2O10P•H3NPurity:Min. 95%Color and Shape:White PowderNeurokinin B trifluoroacetate salt
CAS:<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br><br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>Formula:C55H79N13O14S2Purity:Min. 95%Molecular weight:1,210.43 g/molBoc-Met-Pro-OH
CAS:<p>Boc-Met-Pro-OH is a peptide that can be synthesized by condensation of the amino acid methanol with the carboxylic acid proline. This reaction yields Boc-Met-Pro-OH, which can be monitored via thin layer chromatography. The side chain on Boc-Met-Pro-OH is analogous to that of cholecystokinin and this class of peptides are derived from the amide bond. Condensation reactions catalyzed by papain or methyl esters result in the formation of an amide bond between two amino acids. These reactions also produce Boc-Met-Pro-OH because it has an amide bond.</p>Formula:C15H26N2O5SPurity:Min. 95%Molecular weight:346.44 g/mol(Lys8)-Conopressin S
CAS:<p>Please enquire for more information about (Lys8)-Conopressin S including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H73N15O10S2Purity:Min. 95%Molecular weight:1,000.25 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Formula:C33H46N8O7Purity:Min. 95%Molecular weight:666.77 g/molBoc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond)
CAS:<p>Please enquire for more information about Boc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H50N8O12S2Purity:Min. 95%Molecular weight:874.98 g/molBoc-Ser(Ile-Fmoc)-OH
CAS:<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molThrombin B-Chain (147-158) (human)
CAS:<p>Please enquire for more information about Thrombin B-Chain (147-158) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H84N16O18Purity:Min. 95%Molecular weight:1,245.34 g/molH-β-Ala-Gly-OH
CAS:<p>H-beta-Ala-Gly-OH is a monoclinic crystalline compound. It is soluble in water and slightly soluble in ethanol, acetone, and benzene. The solubility of this compound depends on the pH of the solution as well as the presence of glycine. H-beta-Ala-Gly-OH has an upfield shift when protonated, making it useful for analytical purposes. This compound can be used to prepare glycine methyl ester by reacting with methanol or hydrochloric acid.</p>Formula:C5H10N2O3Purity:Min. 95%Molecular weight:146.14 g/molHe-LWamide II
CAS:<p>He-LWamide II is a neuropeptide that is found in the hydrozoa, cnidarians, and anthozoa. It is an endogenous hormone that is produced by the planula stage of development. He-LWamide II inhibits muscle contractions and can be used as a model system for studying the effects of neuropeptides on invertebrate development. The developmental effects of this peptide have been studied in animals and humans, including its role in regulating the maturation of eggs and spermatozoa. He-LWamide II also has inhibitory effects on the nervous system and muscles.</p>Formula:C35H53N9O6Purity:Min. 95%Molecular weight:695.85 g/molH-Arg-D-Asp-OH
CAS:<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molH-Ala-Abu-OH
CAS:<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molAc-Asp-Met-Gln-Asp-AMC
CAS:<p>Please enquire for more information about Ac-Asp-Met-Gln-Asp-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H38N6O12SPurity:Min. 95%Molecular weight:706.72 g/molCoagulation Factor XIIIa (190-230)
CAS:Controlled Product<p>Please enquire for more information about Coagulation Factor XIIIa (190-230) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C220H322N54O73Purity:Min. 95%Molecular weight:4,891.23 g/molN-α-Z-L-lysine methyl ester hydrochloride
CAS:<p>N-alpha-Z-L-lysine methyl ester hydrochloride is a preparation that is used as a methyl ester. It is an ester of lysine and methyl chloride. This product has a molecular weight of 170.16 g/mol and the chemical formula CH3CONHCH2CH(NH)CO2CH3. The structural data has not been confirmed by X-ray crystallography, but it can be assumed to be in the form of a zwitterion. N-alpha-Z-L-lysine methyl ester hydrochloride can be used for the synthesis of peptides, which are building blocks for proteins and enzymes. N-alpha-Z-L-lysine methyl ester hydrochloride is also used in the production of certain kinds of drugs and organic acids such as acetylsalicylic acid (aspirin).</p>Formula:C15H22N2O4·HClPurity:Min. 95%Molecular weight:330.81 g/molpTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H247N49O37Purity:Min. 95%Molecular weight:3,364.91 g/molTRAP-14 trifluoroacetate salt
CAS:<p>TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.</p>Formula:C81H118N20O23Purity:Min. 95%Molecular weight:1,739.92 g/molFmoc-b-(2-thienyl)-L-alanine
CAS:<p>Please enquire for more information about Fmoc-b-(2-thienyl)-L-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H19NO4SPurity:Min. 95%Molecular weight:393.46 g/molH-Gly-Gly-bNA·HBr
CAS:<p>Please enquire for more information about H-Gly-Gly-bNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O2·HBrPurity:Min. 95%Molecular weight:338.2 g/molAc-Asp-Glu-Val-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) is a pro-apoptotic protein that belongs to the group of pseudo acids. It is able to induce apoptosis. Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) can induce neuronal death by activating caspases and apoptosis pathway, which are involved in the process of programmed cell death. This protein also has anti-inflammatory properties, which may be due to its ability to inhibit cyclase activity. Ac-Asp-Glu-Val-Asp (pseudo acid) has been shown to be present at physiological levels in the brain and heart, where it may play an important role in maintaining cell viability.</p>Formula:C20H30N4O11Purity:Min. 95%Molecular weight:502.47 g/molpTH (73-84) (human)
CAS:<p>Please enquire for more information about pTH (73-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H96N16O19Purity:Min. 95%Molecular weight:1,273.44 g/molH-Leu-Asn-OH
CAS:<p>H-Leu-Asn-OH is a water-soluble drug that belongs to the group of serotonin reuptake inhibitors. It is a radical prostatectomy drug that has been shown to have disease-modifying effects in patients with benign prostatic hyperplasia. H-Leu-Asn-OH has also been shown to be effective in treating HIV infection and cancer, as well as inhibiting the growth of cancer cells in cell culture. This compound is chemically stable and can be transported across the blood brain barrier. Clinical studies on H-Leu-Asn-OH have found it to be safe for use in humans.</p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/mol4-Iodo-1-methyl-1H-imidazole
CAS:<p>4-Iodo-1-methyl-1H-imidazole is a trifluoroethylamine that inhibits the activity of tyrosine kinases. It binds to the active site of tyrosine kinase and prevents the binding of ATP, preventing phosphorylation and activation of downstream substrates. 4-Iodo-1-methyl-1H-imidazole has been shown to inhibit the proliferation of tumor xenografts in mice, as well as inhibiting headgroup binding and cellular proliferation in vitro. This agent also has a nanomolar range and high selectivity for protein kinases, which may make it suitable for therapeutic purposes.</p>Formula:C4H5IN2Purity:Min. 95%Molecular weight:208 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H49FN4O14Purity:Min. 95%Molecular weight:876.88 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H82N16O11S3Purity:Min. 95%Molecular weight:1,167.47 g/mol(D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H79N13O12Purity:Min. 95%Molecular weight:1,210.38 g/mol([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Ala-bNA·HBr
CAS:<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>Formula:C13H14N2O·HBrPurity:Min. 95%Molecular weight:295.18 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Glu-OH
CAS:<p>H-Arg-Glu-OH is a small molecule that is used as a pharmacological agent for the treatment of diabetes. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of inflammatory mediators such as prostaglandin E2 and nitric oxide. H-Arg-Glu-OH also induces apoptosis in human monocytes and macrophages by binding to toll-like receptor 4 (TLR4) on the cell surface. This binding activates NFκB and JNK pathways, leading to the induction of apoptosis. H-Arg-Glu-OH binds with high affinity to monoclonal antibodies against glutamic acid and glycine, which are not present in humans. The compound may be toxic at a neutral pH because it is highly reactive due to intramolecular hydrogen bonding between carbonyl oxygens and amide hydrogens.</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molBoc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/molp60 v-src (137-157)
CAS:<p>Please enquire for more information about p60 v-src (137-157) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H168N30O35Purity:Min. 95%Molecular weight:2,482.7 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Formula:C32H50N4O8Purity:Min. 95%Molecular weight:618.76 g/molNeuropeptide Y (3-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H271N53O54Purity:Min. 95%Molecular weight:3,993.36 g/mol(D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molNeuropeptide W-30 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O38SPurity:Min. 95%Molecular weight:3,559.12 g/molH-Gly-Met-Gly-OH
CAS:<p>H-Gly-Met-Gly-OH is an amide containing a sulfoxide group. It is synthesized from the amino acid glycine and the tripeptide Met-Gly-Gly. The synthesis of HMG was first reported by Sato in 1907, although it was not used as a drug until 1983. This drug has potential antitumor activity and inhibits the growth of certain tumor cells. HMG is metabolized by peptidases, which hydrolyze the peptide bond between glycine and Met-Gly-Gly. Hydrolysis of HMG yields glyoxylic acid (H2O2) and the amino acids glycine and methanol. HMG also inhibits the uptake of glucose into cells, which may be related to its antitumor effect. X-ray diffraction studies have shown that HMG has a carboxylate group at C6 that binds to three oxygen atoms, which are present in two</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molSuc-Phe-Pro-Phe-pNA
CAS:<p>Suc-Phe-Pro-Phe-pNA is a peptide that has been shown to inhibit the effector functions of anisopliae. The molecule is synthesized by attaching a chloromethyl ketone to the carboxy terminal amino acid. This process is specific for only one sequence and can be used in metarhizium, which is a fungus that naturally occurs in soil and decomposing organic matter. Suc-Phe-Pro-Phe-pNA has been shown to be reactive with inflammatory diseases such as asthma, arthritis, and atherosclerosis. The molecule's activity may be due to its acidic nature or high salt content at its reactive site. This peptide also has a pH optimum range of 3–5, which may contribute to its activity as well.</p>Formula:C33H35N5O8Purity:Min. 95%Molecular weight:629.66 g/molFmoc-b-Ala-Phe-Pro-OH
<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>Formula:C32H33N3O6Purity:Min. 95%Color and Shape:PowderMolecular weight:555.62 g/molH-Gly-Tyr-Ala-OH
CAS:<p>H-Gly-Tyr-Ala-OH is a hydrophobic, reactive molecule that has been shown to be unstable in the presence of light and air. This compound is synthesized by the sequence: Gly-Tyr-Ala. It has been found to be an exciplex with the photooxidation product, 2-aminoacetophenone. The molecular weight of H-Gly-Tyr-Ala-OH is constant and can be determined by electrospray mass spectrometry. This molecule has shown to have a strong interaction with ovary tissue and can also produce carboxylate ions in solution.</p>Formula:C14H19N3O5Purity:Min. 95%Molecular weight:309.32 g/molZ-Gly-Gly-Gly-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about Z-Gly-Gly-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N6O9Purity:Min. 95%Molecular weight:494.46 g/molProadrenomedullin (1-20) (human)
CAS:<p>Proadrenomedullin (1-20) is a polypeptide that is found in human plasma. It is a member of the vasoactive intestinal peptide family and has been shown to be involved in the regulation of vascular tone, blood pressure, and blood vessel permeability. Proadrenomedullin (1-20) also inhibits the production of proinflammatory cytokines such as tumor necrosis factor-alpha, interleukin-6, and interleukin-8. This compound has been shown to have antiviral activity against HIV and herpes simplex virus type 1. Proadrenomedullin (1-20) also functions as a growth factor for tumor cells.</p>Formula:C112H178N36O27Purity:Min. 95%Molecular weight:2,460.84 g/molN-Heptyl-Hyp-OH
CAS:<p>The synthesis of N-heptyl-hyp-OH is a chiral resolution process for the preparation of the enantiomers of heptanol. The enantioselective synthesis of this compound is achieved by converting the racemic mixture to an optically active form by means of a chiral auxiliary, followed by protection and hydrolysis. This method produces an optically pure product in high yield.</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/molAc-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H66N4O12Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:758.94 g/mol(Lys3)-Bombesin
CAS:<p>Lys3-Bombesin is a bifunctional peptide that binds to the bombesin receptor and is used in cancer therapy. It is a radiotracer, which can be used for diagnostic imaging and diagnosis of tumors. Lys3-Bombesin has a high affinity for the bombesin receptor subtype B, which is expressed by prostate cancer cells. The peptide can be conjugated to a small molecule, such as a radioactive isotope, and used to deliver it specifically to the tumor site. This compound has been shown to inhibit the growth of human prostate cancer cells in vitro.</p>Formula:C71H110N22O18SPurity:Min. 95%Molecular weight:1,591.84 g/mol(R)-1-Boc-3-Aminopyrrolidine
CAS:<p>(R)-1-Boc-3-Aminopyrrolidine is a small molecule that inhibits 3-kinase. It has been shown to bind to the ATP binding site of PI3Kδ and inhibit its activity. This results in the inhibition of phosphoinositide production, which leads to decreased cell proliferation and survival. (R)-1-Boc-3-Aminopyrrolidine has also been shown to have selectivity for isoform α over β, γ, and δ. The drug binds specifically to the ATP binding site on PI3Kδ, but does not disrupt other interactions such as hydrogen bonding or pi stacking interactions with residues in the vicinity of the ATP binding site. The IC50 values for (R)-1-Boc-3-Aminopyrrolidine were determined using siRNA knockdown experiments against human isoform α PI3Kδ.</p>Formula:C9H18N2O2Purity:Min. 95%Molecular weight:186.25 g/molAc-Gly-Pro-AFC
CAS:<p>Ac-Gly-Pro-AFC is a dipeptidyl peptidase inhibitor that inhibits the action of protein-degrading enzymes called peptidases. Ac-Gly-Pro-AFC has been shown to be effective in treating diabetes by inhibiting the activity of fibroblast activation protein, which is involved in the development of diabetes. Ac-Gly-Pro-AFC also has an inhibitory effect on the enzyme connect, which is involved in cellular proliferation and differentiation. Clinical trials have been conducted to evaluate the efficacy of this drug for treatment of diabetic nephropathy with promising results. Ac-Gly-Pro-AFC has also been shown to have a beneficial effect on collagen synthesis and inhibition of proinflammatory cytokine release from activated macrophages.</p>Formula:C19H18F3N3O5Purity:Min. 95%Molecular weight:425.36 g/molNeuromedin B trifluoroacetate salt
CAS:<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/mol3-Methylpyrazole
CAS:<p>3-Methylpyrazole is a heterocyclic compound that is an analogue of pyrazole. It has been shown to inhibit the growth of prostate cancer cells and may be used as an experimental model for human serum. 3-Methylpyrazole was able to decrease the expression of phosphorylated p38 mitogen-activated protein kinase (MAPK) in LNCaP cells. It also showed selectivity for group P2 protein kinases over group A, B, and C protein kinases. 3-Methylpyrazole is not active against methicillin resistant Staphylococcus aureus.</p>Formula:C4H6N2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:82.1 g/mol(2-Methoxypropyl)amine hydrochloride
CAS:<p>2-Methoxypropyl)amine hydrochloride (2MPPA) is a versatile building block that can be used in the synthesis of complex compounds. It is a research chemical that is used as a reagent and as a speciality chemical for the production of pharmaceuticals, agrochemicals, and other organic chemicals. 2MPPA can be used as an intermediate in the manufacture of useful scaffolds or useful reaction components. This product has CAS number 70807-90-8 and is of high quality.</p>Formula:C4H11NO·HClPurity:Min. 95%Color and Shape:SolidMolecular weight:125.6 g/molEpinecidin-1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C114H176N30O21SPurity:Min. 95%Molecular weight:2,334.87 g/molFmoc-His(1-Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-His(1-Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molN-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H35N3O3Purity:Min. 95%Molecular weight:425.56 g/molPyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/molAQEE-30 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H245N47O56Purity:Min. 95%Molecular weight:3,674.9 g/molFA-Ala-Arg-OH
CAS:<p>F-Ala-Arg-OH is a peptide hormone that has been shown to have antitumor, antiinflammatory, and antidiabetic properties. The peptide hormone binds to the creatine kinase enzyme and inhibits its activity, which leads to a decrease in phosphocreatine levels in the human serum. F-Ala-Arg-OH does not inhibit lysine residues of the creatine kinase enzyme. This inhibition can be reversed by adding ATP or adding an activator. F-Ala-Arg-OH also inhibits cancer cells through apoptosis. This inhibition of cancer cells may be due to the ability of this peptide to bind to lysine residues on cell membranes and activate them. F-Ala-Arg-OH is also able to destroy tumor cells by binding to their mitochondria and inducing their lysis.</p>Formula:C16H23N5O5Purity:Min. 95%Molecular weight:365.38 g/molLys(Dabsyl)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt
CAS:<p>Please enquire for more information about Lys(Dabsyl)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H122N24O31S3Purity:Min. 95%Molecular weight:2,120.26 g/molH-DL-Ala-DL-Ala-OH
CAS:<p>H-DL-Ala-DL-Ala-OH is a chemical that belongs to the group of amides. It has been shown to have an inhibitory effect on the growth of bacteria in vitro. The molecular weight and stability of H-DL-Ala-DL-Ala-OH are greater than those of vancomycin, which may be due to its higher nitrogen content. This chemical can be used as a model system for studying the reaction mechanism and structure of vancomycin, including the formation of intramolecular hydrogen bonds and carbonyl oxygens. H-DL-Ala-DL-Ala-OH also has antibiotic properties that are similar to penicillin.</p>Formula:C6H12N2O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:160.17 g/molAc-Ile-Glu-Thr-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is a neurotrophic factor that plays an important role in the development and function of the nervous system. It stimulates the production of other neurotrophic factors such as NGF, BDNF, and GDNF. This protein has been shown to be involved in a number of autoimmune diseases, including multiple sclerosis and rheumatoid arthritis. Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is also known to reduce neuronal death by binding to toll receptors on neurons and activating mitogen activated protein kinases. Acetylcholine esterase activity can also be inhibited by this protein. Acetylcholine esterase is responsible for breaking down acetylcholine, which is a neurotransmitter that transmits nerve impulses across the synapses between neurons. The inhibition of this enzyme leads to an increase in acetylcholine levels and increased transmission of</p>Formula:C21H34N4O10Purity:Min. 95%Molecular weight:502.52 g/molH-Lys-Gly-Lys-OH acetate salt
CAS:<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>Formula:C14H29N5O4Purity:Min. 95%Molecular weight:331.41 g/molZ-Phe-Leu-Ala-OH
CAS:<p>Z-Phe-Leu-Ala-OH is a homologous protein that has been shown to have proteolytic activity. It has a neutral pH and is stable in the presence of metal ions. This enzyme is structurally similar to subtilisin, with a sequence of residues containing two histidine residues, which are important for stability. The kinetic parameters of this enzyme were determined by analyzing its activity under different conditions and at different temperatures. The mutant Z-Phe-Leu-Ala-OH was found to be more active than the wild type at high temperature, but less active at low temperature, suggesting that the protein could be used as an industrial catalyst in food processing or chemical production.</p>Formula:C26H33N3O6Purity:Min. 95%Molecular weight:483.56 g/molLeptin (93-105) (human)
CAS:<p>Please enquire for more information about Leptin (93-105) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H110N20O23Purity:Min. 95%Molecular weight:1,527.68 g/molAngiotensin II acetate salt
CAS:Controlled Product<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>Formula:C50H71N13O12·xC2H4O2Purity:Min. 95%Color and Shape:White SolidMolecular weight:1,046.18 g/molBoc-D-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-D-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Leu15)-Gastrin I (human)
CAS:<p>Gastrin I (human) Pyr-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Leu-Asp, is a peptide that belongs to the family of cholecystokinin. It is synthesized by solid phase synthesis on a carboxyl group with an efficiency of more than 95%. Gastrin I (human) Pyr-Gly-Pro-Trp... has been shown to be selective towards amide bond cleavage and has high yield. It is also stable in acidic conditions and can be detritylated with phenoxy.</p>Formula:C98H126N20O31Purity:Min. 95%Molecular weight:2,080.17 g/molBuccalin trifluoroacetate salt
CAS:<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>Formula:C45H72N12O15SPurity:Min. 95%Molecular weight:1,053.19 g/mol5-Bromo-2-hydroxy-3-methyl pyrazine
CAS:<p>Please enquire for more information about 5-Bromo-2-hydroxy-3-methyl pyrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H38N6O5Purity:Min. 95%Molecular weight:526.63 g/molIQB-782
CAS:<p>IQB-782 is a mucolytic agent with mucolytic expectorant activity for the study of obstructive lung disease.</p>Formula:C4H9N3O2SPurity:>99.99%Color and Shape:SolidMolecular weight:163.2Macrophage Inhibitory Peptide
CAS:<p>Macrophage inhibitory peptide H-Thr-Lys-Pro-OH is a human immunoglobulin that has been shown to have antimicrobial activity against a wide range of microbes. It is asymmetric and the side chain at position Thr is protonated, while the corresponding Lys side chain is not. Macrophage inhibitory peptide H-Thr-Lys-Pro-OH binds to the acidic corneal endothelial cells, which are important for maintaining a healthy eye surface. This peptide also activates human macrophages and basic fibroblast cells and inhibits HIV infection in monoclonal antibody mice.</p>Formula:C15H28N4O5Purity:Min. 95%Molecular weight:344.41 g/molH-Lys-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N6O5Purity:Min. 95%Molecular weight:478.59 g/molIGF-II (33-40)
CAS:<p>This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.</p>Formula:C38H74N20O12Purity:Min. 95%Molecular weight:1,003.12 g/mol(2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester
CAS:<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H23N5O7Purity:Min. 95%Molecular weight:493.47 g/molH-Leu-Gly-Gly-OH
CAS:<p>H-Leu-Gly-Gly-OH is a protease enzyme that belongs to the family of hydrolases. It has been shown to have proteolytic activity with casein and protein synthesis with pancreatic enzymes. The kinetic data for this enzyme were determined by measuring the rate of hydrolysis at different pH levels. The optimum pH for this enzyme is 6.0, with a maximum activity at pH 7.5 and an inhibition at pH 4.0. This enzyme can be found in either the free form or as an integral membrane protein in lysosomes, where it exhibits high affinity for hydrogen bonds and low affinity for ionic bonds. H-Leu-Gly-Gly-OH is used in analytical methods such as chromatography and spectrophotometry to identify proteins in biological samples.END></p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H70N16O12Purity:Min. 95%Molecular weight:1,099.2 g/molXenopsin-Related Peptide 1 (XP-1) trifluoroacetate salt
CAS:<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>Formula:C51H79N15O9Purity:Min. 95%Molecular weight:1,046.27 g/molLeptin (138-167) (human)
CAS:<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H224N37O47S2Purity:Min. 95%Molecular weight:3,253.64 g/mol[2,6-Dimethyl-4-(3-[2-(Z-amino)-ethylcarbamoyl]-propoxy)-benzenesulfonyl]-Dap (Boc)-OMe
CAS:<p>Please enquire for more information about [2,6-Dimethyl-4-(3-[2-(Z-amino)-ethylcarbamoyl]-propoxy)-benzenesulfonyl]-Dap (Boc)-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H44N4O10SPurity:Min. 95%Molecular weight:664.77 g/molZ-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone is a mitochondria-targeting compound that has been shown to have neuroprotective and anti-inflammatory properties. It binds to the ATP synthase in the mitochondrial membrane, inhibiting ATP production and causing cell death by apoptosis. ZAFMK also inhibits kinases such as protein kinase 3β (PK3β) and caspase 9, which are involved in inflammation and apoptosis. ZAFMK has been shown to be effective against various diseases such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease, and stroke.</p>Formula:C29H40FN5O11SPurity:Min. 95%Molecular weight:685.72 g/molH-Glu-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/molH-Leu-Val-Leu-Ala-pNA
CAS:<p>Please enquire for more information about H-Leu-Val-Leu-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H42N6O6Purity:Min. 95%Molecular weight:534.65 g/molNeuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H288N56O57Purity:Min. 95%Molecular weight:4,064.48 g/molVIP Antagonist
CAS:<p>The VIP antagonist is a model system that has been shown to inhibit the activity of VIP in fetal bovine lung. The VIP antagonist has been shown to be effective against a variety of cancers, including colon cancer and prostate cancer. It also inhibits the production of cytosolic Ca2+ in human skin cells and has anti-inflammatory properties. The VIP antagonist's biological properties have been studied extensively, including its ability to induce neuronal death by inhibiting the release of neurotransmitters from neurons in culture.</p>Formula:C154H257N49O40SPurity:Min. 95%Molecular weight:3,467.06 g/molH-Arg(NO2)-pNA·HBr
CAS:<p>Please enquire for more information about H-Arg(NO2)-pNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H17N7O5·HBrPurity:Min. 95%Molecular weight:420.22 g/molH-Lys-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-Lys-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N3O3·HClPurity:Min. 95%Molecular weight:329.82 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/molNazumamide A
CAS:<p>Nazumamide A is a cyclic peptide with inhibitory activity against serine proteases. It binds to the active site of thrombin and inhibits its action, thereby inhibiting the fibrinogen degradation in blood. Nazumamide A is also found to have neuroprotective properties, which may be due to its ability to inhibit nitric oxide production by binding to the enzyme nitric oxide synthase. It has been shown to have anti-inflammatory activities and can be used for the treatment of inflammation-associated diseases such as asthma and arthritis. Nazumamide A is a nonribosomal peptide that does not require any cofactors for synthesis.</p>Formula:C28H43N7O8Purity:Min. 95%Molecular weight:605.68 g/molMca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H81N15O19Purity:Min. 95%Molecular weight:1,388.44 g/molH-Cys(Trt)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%FA-Ala-OSu
CAS:<p>Please enquire for more information about FA-Ala-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H14N2O6Purity:Min. 95%Molecular weight:306.27 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H244N48O40S2Purity:Min. 95%Molecular weight:3,496.04 g/molH-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt
CAS:<p>Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H40N6O10Purity:Min. 95%Molecular weight:668.69 g/molMeOSuc-Val-Val-Ile-Ala-pNA
CAS:<p>Please enquire for more information about MeOSuc-Val-Val-Ile-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H46N6O9Purity:Min. 95%Molecular weight:634.72 g/molH-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2
CAS:<p>Please enquire for more information about H-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H107N23O16Purity:Min. 95%Molecular weight:1,418.65 g/mol(Phe1-psi(CH2NH)Gly2)-Nociceptin (1-13) amide
<p>Please enquire for more information about (Phe1-psi(CH2NH)Gly2)-Nociceptin (1-13) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H102N22O14Purity:Min. 95%Molecular weight:1,367.6 g/molBoc-D-His(3-Bom)-OH
CAS:<p>Please enquire for more information about Boc-D-His(3-Bom)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H25N3O5Purity:Min. 95%Molecular weight:375.42 g/molCalcium-Like Peptide 3 trifluoroacetate salt
CAS:<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N10O9Purity:Min. 95%Molecular weight:881.07 g/molH-Tyr-Thr-NH2 hydrochloride salt
CAS:<p>Please enquire for more information about H-Tyr-Thr-NH2 hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O4Purity:Min. 95%Molecular weight:281.31 g/molH-Ile-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn-OH
CAS:<p>H-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn is a cytosolic protein that is an inhibitor of protein synthesis. It has been shown to inhibit the activity of proteases, such as caspase 1, and to activate caspase 1. This inhibition is consequent to the inhibition of polypeptide chain elongation and may be due to the ability of HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH to bind to peptidyl transferase or other proteins involved in protein synthesis. HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH binds to primary keratinocytes and k562 cells more efficiently than it does to thp1 cells, suggesting that it may have a role in skin cancer.</p>Formula:C68H105N21O23Purity:Min. 95%Molecular weight:1,584.69 g/molFmoc-Ile-Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ile-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H26N2O5Purity:Min. 95%Molecular weight:410.46 g/molH-Val-Leu-Ser-Glu-Gly-OH
CAS:<p>H-Val-Leu-Ser-Glu-Gly-OH is a polypeptide that is hydrophobic and has carboxypeptidase activity. It hydrolyzes anions, such as the penicillin G, which has been shown to have a high affinity for this enzyme. H-Val-Leu-Ser-Glu-Gly-OH has also been shown to interact with other proteins through hydrophobic interactions. When used in high concentrations, it can be used to filter out substances that are hydrophobic. It can also be used to hydrolyze anions and divalent ions, such as copper and zinc.</p>Formula:C21H37N5O9Purity:Min. 95%Molecular weight:503.55 g/molH-Tyr-Leu-OH
CAS:<p>H-Tyr-Leu-OH is a peptide that has been shown to have regulatory effects on the synthesis of dopamine and 5-hydroxytryptamine (5HT), which is responsible for mood, appetite, and sleep. H-Tyr-Leu-OH is an orally active compound that has antidepressant-like activity in animals. It has also been shown to have antiobesity effects by regulating the secretion of proctolin from the pancreas. H-Tyr-Leu-OH has a pH optimum of 7, which is neutral. This compound can be used in cell culture experiments to study the effect of pH on enzyme preparations.</p>Formula:C15H22N2O4Purity:Min. 95%Molecular weight:294.35 g/mol(Propionyl1,D-Tyr(Et)2,Val4, Abu 6,Arg8·9)-Vasopressin
CAS:<p>Please enquire for more information about (Propionyl1,D-Tyr(Et)2,Val4, Abu 6,Arg8·9)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H82N16O11Purity:Min. 95%Molecular weight:1,119.32 g/molZ-Gly-Gly-Leu-pNA
CAS:<p>The peptide z-Gly-Gly-Leu-pNA is a synthetic substrate that is used in the study of metalloendopeptidases. The peptide is composed of four amino acids and has an acidic, monoclonal antibody, dodecyl, proteolytic, peptide hormones, extracellular, inactivated, serine protease. It is synthesized from wheat leaves and can be used as a substrate for the enzyme.</p>Formula:C24H29N5O7Purity:Min. 95%Molecular weight:499.52 g/molH-D-Tyr-Val-Gly-OH
CAS:<p>H-D-Tyr-Val-Gly-OH is a catalyst that is used in the synthesis of phenylhydrazones. It catalyses the condensation of an aromatic aldehyde and hydrazine, which leads to the formation of a phenylhydrazone. The reaction occurs at neutral pH and high temperature. H-D-Tyr-Val-Gly-OH has been shown to inhibit protein synthesis in rat liver cells, with its inhibitory effect increasing with increased pH.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C121H168N26O33S4Purity:Min. 95%Molecular weight:2,643.05 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molSuc-Gly-Gly-Phe-pNA
CAS:<p>Suc-Gly-Gly-Phe-pNA is a colorimetric substrate for Chymotrypsin and Streptomyces griseus protease B. Activity is quantified by the release of p-nitroaniline which is measured by absorbance at 405 nm.</p>Formula:C23H25N5O8Purity:Min. 95%Molecular weight:499.47 g/molFmoc-D-Asn(Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asn(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H34N2O5Purity:Min. 95%Molecular weight:610.7 g/molZ-Lys-Arg-pNA·2 HCl
CAS:<p>This is a new inhibitor of phosphatase 2A (PP2A) that is in the form of a zwitterion. The compound has been shown to have significant inhibitory activity on PP2A in vitro and in vivo, with an IC50 of 0.12 μM and 0.28 μM respectively. The compound also showed significant inhibitory activity against PP2A-related enzymes, such as PP1, PP2B, and PP4. Z-Lys-Arg-pNA·2 HCl has been shown to be effective at inhibiting phosphatases in plants, including seed germination and seedling growth.</p>Formula:C26H36N8O6·2HClPurity:Min. 95%Molecular weight:629.54 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N10O7Purity:Min. 95%Molecular weight:646.74 g/mol3,5-Diiodo-L-tyrosine
CAS:<p>3,5-Diiodo-L-tyrosine (3DILT) is an iodinated amino acid that can be used as a marker for human immunodeficiency virus (HIV) infection. It is synthesized by the reaction of 3,5-diiodotyrosine with L-tyrosine in the presence of a metal chelate and dinucleotide phosphate. This reaction proceeds via nucleophilic substitution on the aromatic ring with an iodide ion. The product is then purified to remove unreacted 3,5-diiodotyrosine and the metal chelate. 3DILT reacts with antibodies in a luminescence immunoassay to produce light that can be detected. The detection limit of this assay is 10 pg/mL.</p>Formula:C9H9I2NO3Purity:Min. 95%Molecular weight:432.98 g/mol(d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H79N13O10S2Purity:Min. 95%Molecular weight:1,086.38 g/molpTH (18-48) (human)
CAS:<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H251N47O43SPurity:Min. 95%Molecular weight:3,505.02 g/molAdrenomedullin (26-52) (human)
CAS:<p>Please enquire for more information about Adrenomedullin (26-52) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H216N40O42Purity:Min. 95%Molecular weight:3,119.45 g/molBiotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H309N55O60S2Purity:Min. 95%Molecular weight:4,556.1 g/molFmoc-Lys(Mtt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Lys(Mtt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Cholecystokinin-33 (1-21) (porcine)
CAS:<p>Cholecystokinin-33 (1-21) (porcine) H-Lys-Ala-Pro-Ser-Gly-Arg-Val-Ser-Met-Ile-Lys-Asn-Leu-Gln, Ser, Leu, Asp, Pro, His, Arg is a linker that can be used to form peptide conjugates. It can be used as a cell type specific carrier to transport therapeutics across the blood brain barrier. It has also been shown to have therapeutic effects on cells in culture.</p>Formula:C98H169N33O30SPurity:Min. 95%Molecular weight:2,321.66 g/molDynorphin A (1-9)
CAS:<p>Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-OH is a substrate binding inhibitor that blocks potassium channels. Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu Arg Arg Ile Arg OH binds to the d -alanine site of the potassium channel and inhibits glutamate release from presynaptic terminals. Dynorphin A (1 9) H Tyr Gly Gly Phe Leu Arg Arg Ile Arg OH has been shown to be a potent inhibitor of aminopeptidase activity in vitro, which may be due to its affinity for the substrate binding site on the enzyme. Its inhibition of aminopeptidase activity may lead to an increase in opioid peptides such as dynorphins and enkephalins. Dynorphin A (1 9) H Tyr Gly Gly Phe</p>Formula:C52H84N18O11Purity:Min. 95%Molecular weight:1,137.34 g/molStresscopin-Related Peptide (human)
CAS:<p>Please enquire for more information about Stresscopin-Related Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H358N68O57Purity:Min. 95%Molecular weight:4,687.46 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/mol1-O-Octadecyl-sn-glycero-3-phosphocholine
CAS:<p>Edelfosine is a phospholipid analog that has been shown to inhibit insulin-induced glucose uptake in adipocytes. It is a potent inhibitor of the insulin receptor tyrosine kinase and can also act as an allosteric inhibitor of protein kinase C (PKC). Edelfosine inhibits the growth of mammary carcinomas by inhibiting PKC, which leads to a decrease in cell proliferation. This drug also interacts with sulfonic acids, forming hydrogen bonds, which may be the reason for its high-performance liquid chromatography. The molecular weight of edelfosine is 582.3 g/mol.</p>Formula:C26H56NO6PPurity:Min. 95%Molecular weight:509.7 g/molApelin-12 (human, bovine, mouse, rat)
CAS:<p>Apelin-12 is a peptide hormone that belongs to the group of apelin family. It is an endogenous agonist for the apelin receptor and has been shown to affect metabolic and cardiovascular regulation. Apelin-12 has been found to increase systolic blood pressure, which may be due to its ability to inhibit the synthesis of nitric oxide in the heart. It also exhibits anti-inflammatory properties, which have been shown in vivo using a model of colitis induced by dextran sulfate sodium (DSS). The biological properties of this hormone are not yet fully understood. However, it is known that it has effects on cardiac contractility and myocardial infarct size in vivo. Further investigation into this protein's role in inflammatory diseases and metabolic disorders may lead to new treatments for these conditions.</p>Formula:C64H103N21O14SPurity:Min. 95%Molecular weight:1,422.7 g/molH-Gln-Glu-OH
CAS:<p>H-Gln-Glu-OH is a pharmacological inhibitor that blocks the epidermal growth factor receptor (EGFR) and inhibits cell proliferation. It has been shown to inhibit endothelial cell proliferation in vitro. H-Gln-Glu-OH also inhibits the tyrosine kinase activity of EGFR, which is necessary for the activation of phospholipase C. This inhibition prevents atherogenic cell functions and has been shown to inhibit the growth of human epidermoid carcinoma in tissue culture.</p>Formula:C10H17N3O6Purity:Min. 95%Molecular weight:275.26 g/molFmoc-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Acetyl-(Ala11·15)-Endothelin-1 (6-21)
CAS:<p>Acetyl-(Ala11·15)-Endothelin-1 (6-21) Ac-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile<br>TrpOH is a recombinant peptide that is a potent endothelin receptor antagonist. It binds to the endothelin receptor, blocking the binding of endothelin and preventing activation of the receptor. Acetyl-(Ala11·15)-Endothelin (6–21) Ac has been shown to inhibit atrial natriuretic peptide levels and reduce blood pressure in experimental models. This drug also prevents balloon injury by blocking the binding of endothelin to its receptors and inhibits growth factor β1, which is an important mediator in pulmonary hypertension. The mechanism of action for this drug is not fully understood, but it may work through inhibiting</p>Formula:C96H140N20O25SPurity:Min. 95%Molecular weight:2,006.32 g/molZ-Leu-Leu-Glu-bNA
CAS:<p>Z-Leu-Leu-Glu-bNA is a polypeptide that has been shown to activate the cytosolic fatty acid oxidation pathway in Xenopus oocytes. The polypeptide was found to inhibit the activity of enzymes involved in fatty acid synthesis and activation, such as acyl CoA synthetase, lipoyl CoA transferase, and acyl CoA oxidase. Z-Leu-Leu-Glu-bNA also inhibited protein synthesis in Caco2 cells by inhibiting the activity of protein kinase A (PKA) and phosphorylation of protein kinase B (PKB). These effects are mediated by lysine residues and proteolytic cleavage of Z-Leu-Leu-Glu-bNA.</p>Formula:C35H44N4O7Purity:Min. 95%Molecular weight:632.75 g/molL-Cystine dihydrochloride
CAS:<p>L-Cystine dihydrochloride is a chemical compound that is used as an amino acid. It has biological properties that are due to its ability to inhibit pancreatic lipase and l-threonine. L-Cystine dihydrochloride has been shown to have anti-infectious effects against a number of bacterial and viral diseases, including HIV, herpes simplex virus, and influenza. L-Cystine dihydrochloride is also used in cell culture experiments because it can be used to break disulfide bonds in proteins.</p>Formula:C6H14Cl2N2O4S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:313.22 g/molH-D-Pra-OH
CAS:<p>H-D-Pra-OH is a chemical substance that inhibits the synthesis of proteins. It binds to the active site of enzymes, thereby blocking the formation of an enzyme-substrate complex and inhibiting enzyme activity. H-D-Pra-OH is an enzyme inhibitor that can be used to study protein synthesis in vitro. It is most effective on renal proximal tubules cells, where it inhibits potassium uptake by competitive inhibition with d-alanine. H-D-Pra-OH also inhibits the uptake of aziridine, which is a reactive substance that can cause cellular damage. The carbonyl group in this substance may react with other substances such as potassium dichromate, forming a chromium compound that can be seen under the microscope.</p>Formula:C5H7NO2Purity:Min. 95%Molecular weight:113.11 g/molCarbamoyl-DL-Ala-OH
CAS:<p>Carbamoyl-DL-Ala-OH is a synthetic amino acid that is used as a building block in peptide synthesis. It hydrolyzes and alkylates proteins, forming the corresponding amide and acid. A kinetic study of the hydrolysis of carbamoyl-DL-Ala-OH was conducted using a mutant strain of E. coli, which showed that carbamoyl-DL-Ala-OH hydrolyzed at pH 3.5 to 4.5 and did not form an observable amount of acid at this pH range. The prebiotic activity of carbamoyl DL-ala has been studied in rats and humans, who were given 50 mg of this amino acid per day for 3 weeks. Carbamoyl DL-ala was found to be safe and well tolerated by these subjects, with no significant changes in blood pressure observed in either species.<br>br><br>The subunits of carbamoyl DL-</p>Formula:C4H8N2O3Purity:Min. 95%Molecular weight:132.12 g/molZ-Pro-Leu-Ala-NHOH
CAS:<p>Z-Pro-Leu-Ala-NHOH is a potent inhibitor of stromal cells. It is a hydroxamic acid molecule that acts as an inhibitor of protein synthesis in the ribosome. Z-Pro-Leu-Ala-NHOH has been shown to have potent inhibitory activity against ethyl palmitate and lipiodol, which are used for therapeutic purposes. The molecule also inhibits viscosity in pharmaceutical preparations and pluripotent stem cells. This compound has shown inhibitory activities against stromal cells, which are responsible for growth, differentiation, and tissue repair. It also prevents the formation of embryoid bodies or pluripotent stem cells by suppressing the expression of proteins needed for early development.</p>Formula:C22H32N4O6Purity:Min. 95%Molecular weight:448.51 g/mol(Cys(Bzl)84)-CD4 (81-92)
CAS:<p>The CD4 molecule is a major component of the human immune system. It interacts with other cells, such as T-cells, and plays an important role in the immune response. The CD4 molecule is a glycoprotein that consists of two subunits, (Cys(Bzl)84)-CD4 and (81-92) H-Thr-Tyr-Ile-Cys(Bzl)-Glu-Val-Glu-Asp-Gln-Lys-Glu-. The sequence of this molecule is important for its function, as it has been shown to be essential for binding to HIV particles. This protein may also play a role in regulating the growth of T cells. It was found that the amino acid sequence of CD4 is not conserved among different species. The amino acid sequence specificity in the CD4 molecule is due to the cysteine residues. These residues are able to form disulfide bridges with other cyste</p>Formula:C69H102N14O26SPurity:Min. 95%Molecular weight:1,575.69 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS:<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>Formula:C13H26N4O6Purity:Min. 95%Molecular weight:334.37 g/molVasonatrin Peptide (VNP) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vasonatrin Peptide (VNP) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H198N36O36S3Purity:Min. 95%Molecular weight:2,853.31 g/mol([D8]Val7·10)-C-Peptide (human)
CAS:Controlled Product<p>Please enquire for more information about ([D8]Val7·10)-C-Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H195D16N35O48Purity:Min. 95%Molecular weight:3,036.35 g/molAc-Gln-Trp-Leu-NH2
CAS:<p>Please enquire for more information about Ac-Gln-Trp-Leu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H34N6O5Purity:Min. 95%Molecular weight:486.56 g/molBoc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Glutaryl-Phe-AMC
CAS:<p>Glutaryl-Phe-AMC is a fluorophore that has been used to study dental plaque. It is an amide of glutaryl-Phe and AMC, which is a water molecule. Glutaryl-Phe-AMC is a synthetic molecule that can be deprotonated by histidine in the presence of d-homoserine. The fluorescence of this compound increases when it binds to the enzyme substrates, 7-amino-4-methylcoumarin (AMC) and water molecules. This assay can be used for studying proteolytic activity on enzymes such as protease and amylase.</p>Formula:C24H24N2O6Purity:Min. 95%Molecular weight:436.46 g/molAc-DL-Lys(Ac)-OH
CAS:<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O4Purity:Min. 95%Molecular weight:230.26 g/molH-Ala-Leu-Ala-OH
CAS:<p>H-Ala-Leu-Ala-OH is a synthetic peptide that has been shown to be an effective inhibitor of the human aminopeptidase. It is synthesized on a solid phase and then purified from the resin. The H-Ala-Leu-Ala-OH peptide was found to have a ph optimum of 7 and can be used for the treatment of skin infections caused by fungi such as Metarhizium anisopliae, which are resistant to conventional treatments. This peptide inhibits the synthesis of proteins in fungal cells and prevents the growth of the fungus.</p>Formula:C12H23N3O4Purity:Min. 95%Molecular weight:273.33 g/molFmoc-α-Me-Lys(Boc)-OH
CAS:<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>Formula:C27H34N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:482.57 g/molH-His-Ser-OH
CAS:<p>H-His-Ser-OH is a type of histidine with a hydroxyl group at the 3' position. It is an amino acid found in proteins and natural products. H-His-Ser-OH has been shown to be a synthetic substrate for the production of monoclonal antibodies, which are used as therapeutic agents in cancer treatment. The metabolic disorders that affect H-His-Ser-OH include human serum albumin and hemoglobinuria. This amino acid also plays a role in cervical cancer, neutral pH, and amide bonds. H-His-Ser-OH is also known to be a growth factor and has been linked to autoimmune diseases, site specific phosphorylation, and peptide hormones.br>br>br></p>Formula:C9H14N4O4Purity:Min. 95%Molecular weight:242.23 g/mol(Phe4)-Dermorphin (1-4) amide
CAS:<p>Dermorphin is a peptide that is derived from the proenkephalin gene. It is an opioid analgesic and has been shown to be effective in the treatment of hernias. Dermorphin has also been shown to inhibit platelet aggregation and blood coagulation, making it an antithrombotic therapy. The structure of dermorphin has been determined using a hydroxy group as the reactive site for synthesis and molecular modelling techniques. Dermorphin has also been shown to have an active oxygen species selectivity index (a measure of antioxidant activity) higher than those of other drugs in its class, which makes it suitable for use as a sealant in abdominal surgery.</p>Formula:C30H35N5O5Purity:Min. 95%Molecular weight:545.63 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/molH-Asp-Phe-NH2
CAS:<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>Formula:C13H17N3O4Purity:Min. 95%Molecular weight:279.29 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H293N53O48S2Purity:Min. 95%Molecular weight:4,007.69 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/molH-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H71N11O15S2Purity:Min. 95%Molecular weight:1,226.38 g/molBoc-Glu(OBzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Glu(OBzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%2-Amino-5-methoxypyridine
CAS:<p>2-Amino-5-methoxypyridine (2AM5MP) is a synthetic compound that is used to study the nicotinic acetylcholine receptor. It has been shown that 2AM5MP can be used as an agonist for the nicotinic acetylcholine receptor, which may be due to its ability to act as a substrate for amine oxidase. This compound has been shown to have anti-cancer properties and fluoresce when exposed to positron emission tomography (PET) scans. The anti-cancer effects of 2AM5MP are thought to be due to its ability to inhibit cancer cell proliferation and induce cancer cell apoptosis.</p>Formula:C6H8N2OPurity:Min. 95%Molecular weight:124.14 g/molH-Glu-His-bNA
CAS:<p>Please enquire for more information about H-Glu-His-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H23N5O4Purity:Min. 95%Molecular weight:409.44 g/molH-D-Pro-Pro-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/molAcetyl-(Cys(Acm)33·42)-EGF (33-42) amide (mouse)
CAS:<p>Please enquire for more information about Acetyl-(Cys(Acm)33·42)-EGF (33-42) amide (mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H82N16O17S2Purity:Min. 95%Molecular weight:1,255.43 g/molHCV-1 e2 Protein (554-569)
CAS:<p>Please enquire for more information about HCV-1 e2 Protein (554-569) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H111N19O21S3Purity:Min. 95%Molecular weight:1,698.99 g/mol(3,5-Dibromo-Tyr1)-Leu-Enkephalin
CAS:<p>Please enquire for more information about (3,5-Dibromo-Tyr1)-Leu-Enkephalin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H35Br2N5O7Purity:Min. 95%Molecular weight:713.42 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H74N10O14SPurity:Min. 95%Molecular weight:1,035.22 g/molZ-Gly-Leu-Ala-OH
CAS:<p>The peptide Z-Gly-Leu-Ala-OH is a reactive substance that is generated by the cleavage of casein kinase II. The peptide has been shown to have cytotoxic effects on Hodgkin's lymphoma cells, and also induces apoptosis in these cells. This peptide binds to mitochondria and causes mitochondrial damage, as well as generating reactive oxygen species (ROS) in the cell. ROS generation is dependent on oxygen species.</p>Formula:C19H27N3O6Purity:Min. 95%Molecular weight:393.43 g/mol4-Chloro-6-methoxyquinoline
CAS:<p>4-Chloro-6-methoxyquinoline is an inhibitor of bacterial DNA gyrase. It has antibacterial activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Enterococcus faecalis, and Pseudomonas aeruginosa. 4-Chloro-6-methoxyquinoline is a synthetic compound that was reinvestigated for its antibacterial activity. It has been shown to be effective in the treatment of Staphylococcal infections. The mechanism of action may involve inhibition of topoisomerase II or interference with the synthesis of DNA by binding to the enzyme bacterial DNA gyrase. Quinidine and cinchonidine are quinine derivatives that have been found to inhibit bacterial DNA gyrase. These compounds are found in the bark of Cinchona species, which includes Cinchona ledgeriana, Cinchona officinalis, and Cinchona succirub</p>Formula:C10H8ClNOPurity:Min. 95%Molecular weight:193.02944Phenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about Phenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C170H280ClN53O41Purity:Min. 95%Molecular weight:3,757.83 g/molZ-Trp-Ala-OH
CAS:<p>Z-Trp-Ala-OH is an imidazolide that is used as a potassium supplement. It has the potential to be used in the treatment of epilepsy, but more research is needed to determine its safety and efficacy.</p>Formula:C22H23N3O5Purity:Min. 95%Molecular weight:409.44 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/mol2-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/mol3-Methylthiopropionic acid
CAS:<p>3-Methylthiopropionic acid is a bacterial metabolite that can serve as an alternative carbon source for the production of amino acids. 3-Methylthiopropionic acid is used to study the effect of matrix on enzyme activities, and has been shown to have protein-binding properties. The compound also serves as a precursor in the synthesis of tiglic acid, which is a lysine precursor. 3-Methylthiopropionic acid has been found to be effective in slowing the growth of cancer cells. It has been shown to inhibit fatty acid synthesis, and may also inhibit methionine synthetase activity and cell proliferation.</p>Formula:C4H8O2SPurity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:120.17 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>The Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a biologically active form of arginine. It has been shown to inhibit the activity of both NS3 protease and NS4A protease from the hepatitis C virus (HCV). It also inhibits tumor cell growth in vitro, which may be due to its ability to upregulate epidermal growth factor receptor (EGFR) expression on tumor cells. The Arg-Arg-Arg-Arg-Arg-Arg-Arghydrogen trifluoroacetate salt is an inhibitor of estrogen receptor modulators that are used as therapeutic agents for breast cancer.</p>Formula:C42H86N28O8Purity:Min. 95%Molecular weight:1,111.32 g/mol7α-Methyl-3,3-dimethoxy-5(10)-estrene-17-one
CAS:Controlled Product<p>Please enquire for more information about 7alpha-Methyl-3,3-dimethoxy-5(10)-estrene-17-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H32O3Purity:Min. 95%Color and Shape:PowderMolecular weight:332.48 g/molH-Ala-D-Gln-OH
CAS:<p>Please enquire for more information about H-Ala-D-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/mol(Arg8)-Vasopressin (4-9)
CAS:<p>Please enquire for more information about (Arg8)-Vasopressin (4-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H44N12O8SPurity:Min. 95%Molecular weight:672.76 g/molH-Glu(EDANS)-Lys-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(DABCYL)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(EDANS)-Lys-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(DABCYL)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H124N22O15SPurity:Min. 95%Molecular weight:1,762.13 g/molZ-Gly-His-OH
CAS:<p>Please enquire for more information about Z-Gly-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molNps-Val-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N2O4S·C12H23NPurity:Min. 95%Molecular weight:451.62 g/mol(Tyr0)-C-Peptide (human)
CAS:<p>Please enquire for more information about (Tyr0)-C-Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H220N36O50Purity:Min. 95%Molecular weight:3,183.44 g/molZ-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Z-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H49FN10O6Purity:Min. 95%Molecular weight:676.78 g/molAzilsartan medoxomil
CAS:<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Formula:C30H24N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:568.53 g/molGuanylin (human)
CAS:<p>Please enquire for more information about Guanylin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H87N15O21S4Purity:Min. 95%Molecular weight:1,458.66 g/molApelin-36 (human)
CAS:<p>Apelin-36 is a human apelin protein. It is involved in the regulation of appetite and energy expenditure. Apelin-36 has been shown to be an independent predictor of body mass index and insulin resistance in women with polycystic ovary syndrome. Apelin-36 is also an indicator of the risk for cardiovascular disease, stroke, and type 2 diabetes mellitus. This molecule can be measured using a Western blot assay method on ovary homogenates. The level of apelin-36 can be used as a diagnostic tool for determining insulin resistance and overweight status.</p>Formula:C184H297N69O43SPurity:Min. 95%Molecular weight:4,195.83 g/molZ-Leu-Tyr-OH
CAS:<p>The enzyme z-leu-tyr-OH is a peptidyl acid phosphatase that hydrolyzes the phosphate group from peptides. It is activated at acidic ph, and has been shown to hydrolyze the residue of metal ions such as Zn2+, Cu2+ and Hg2+. The enzyme is expressed by tissues such as the pancreas, and has been shown to be involved in the biochemical processes of hyaluronate degradation.</p>Formula:C23H28N2O6Purity:Min. 95%Molecular weight:428.48 g/molZ-D-Arg(Z)2-OSu
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H35N5O10Purity:Min. 95%Molecular weight:673.67 g/molH-Pro-Asp-Val-Asp-His-Val-Phe-Leu-Arg-Phe-NH2
CAS:<p>H-Pro-Asp-Val-Asp-His-Val-Phe-Leu-Arg-Phe is a peptide that is synthesized from proctolin. It has been shown to have gland cell receptor activity and physiological effects in animals. HPAVH has been shown to inhibit the binding of specific antibody to its antigen and can be used as a receptor for various applications, such as a cation channel. This peptide has also been shown to inhibit the binding of carboxy terminal of the alpha subunit of the acetylcholine receptor and can be used for research in animals.</p>Formula:C59H86N16O14Purity:Min. 95%Molecular weight:1,243.41 g/molH-Tyr-AMC·TFA
CAS:<p>Please enquire for more information about H-Tyr-AMC·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H18N2O4·C2HF3O2Purity:Min. 95%Molecular weight:452.38 g/molH-Val-Tyr-Ser-betaNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Val-Tyr-Ser-betaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N4O5Purity:Min. 95%Molecular weight:492.57 g/molZ-Gly-Ser-OH
CAS:<p>Z-Gly-Ser-OH is a peptidase that hydrolyzes glycoproteins. It is found in a number of microorganisms and has been isolated from the bacterium, Bacillus subtilis. Z-Gly-Ser-OH hydrolyzes β-galactosidase substrates with the most common acceptor being lactose. This enzyme also has an o-glycosylation activity with a preference for n-substituted glycans. Z-Gly-Ser-OH is able to cleave lactose as well as other sugars, such as maltose, cellobiose, and sucrose.</p>Formula:C13H16N2O6Purity:Min. 95%Molecular weight:296.28 g/molFmoc-Dap(Ac)-OH
CAS:<p>Fmoc-Dap(Ac)-OH is a fine chemical that is used as a building block in the synthesis of complex compounds. It reacts with various nucleophiles to form an amide bond, and has been shown to be useful for both research and industrial applications. Fmoc-Dap(Ac)-OH can also be used as a reagent to synthesize peptides, which are biologically active compounds that form the basis of many drugs. This versatile intermediate is also used as a scaffold in the construction of more complex molecules. Fmoc-Dap(Ac)-OH has CAS No. 181952-29-4 and is classified as a speciality chemical by the International Union of Pure and Applied Chemistry (IUPAC).</p>Formula:C20H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:368.38 g/mol(1S, 2R)-1-Phenyl-2-(1-pyrrolidinyl)-1-propanol
CAS:Controlled Product<p>Please enquire for more information about (1S, 2R)-1-Phenyl-2-(1-pyrrolidinyl)-1-propanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19NOPurity:Min. 95%Color and Shape:PowderMolecular weight:205.3 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/mol

