
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,436 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38216 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formula:C61H76N12O14SPurity:Min. 95%Molecular weight:1,233.39 g/molH-Trp-Gly-Gly-Tyr-OH
CAS:<p>Please enquire for more information about H-Trp-Gly-Gly-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N5O6Purity:Min. 95%Molecular weight:481.5 g/mol(Glu2)-TRH Pyr-Glu-Pro-NH2
CAS:<p>(Glu2)-TRH Pyr-Glu-Pro-NH2 is a colony-stimulating factor that has been shown to play a role in fertility and energy metabolism. It is also involved in the regulation of physiological functions, such as spermatozoa motility and enzyme inhibitors. (Glu2)-TRH Pyr-Glu-Pro-NH2 binds to its receptor on the surface of cells and stimulates cell growth. The biological function of this drug is not yet known.</p>Formula:C15H22N4O6Purity:Min. 95%Molecular weight:354.36 g/molH-Val-Asn-OH
CAS:<p>H-Val-Asn-OH is a polyhydroxyamine that is soluble in water and has a low freezing point. It can be used as a coating material, sectioning medium, or to study the thermal expansion of materials. H-Val-Asn-OH has been shown to have no significant effect on the growth rate of bacteria and spores. H-Val-Asn-OH is made up of nitrogen atoms, ferrite, and strain. The microstructure of H-Val-Asn-OH includes a phase equilibrium with ferrite and strain morphology.</p>Formula:C9H17N3O4Purity:Min. 95%Molecular weight:231.25 g/mol4-Amino-3-methoxypyridine
CAS:<p>4-Amino-3-methoxypyridine (4AMMP) is a naturally occurring amino acid that can be found in the nuclei of innervated tissues. It is an inhibitor of the enzyme tyrosine hydroxylase and inhibits the synthesis of catecholamines. The concentration of 4AMMP in blood was measured by radioactivity. This agent has been used for studies on the thalamic nucleus and cortex, as well as for measuring catecholamine levels in tissue homogenates.</p>Formula:C6H8N2OPurity:Min. 95%Molecular weight:124.14 g/molAc-Phe-Phe-OH
CAS:<p>Please enquire for more information about Ac-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O4Purity:Min. 95%Molecular weight:354.4 g/molH-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Lys-Tyr-Met-Val-D-Met-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H61N9O7S2·C2HF3O2Purity:Min. 95%Molecular weight:970.13 g/mol(Gly14)-Humanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C118H202N34O31S2Purity:Min. 95%Molecular weight:2,657.21 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N12O13PPurity:Min. 95%Molecular weight:1,055.04 g/molTrt-Cys(Trt)-OH
CAS:<p>Trt-Cys(Trt)-OH is a selective dicyclohexyl carbodiimide reagent for the synthesis of amides from carboxylic acids. It is used as an intermediate in the synthesis of glutathione and other nitrogen-containing compounds. Trt-Cys(Trt)-OH reacts with hydrochloric acid to form a salt, which can be saponified to release the desired product. The hydrochloric acid converts the ester into a carboxylic acid, while the amine group on the glycine reacts with the carboxylic acid to form an amide. Trityl is also produced during this reaction, which can be removed by reduction with hydrogen gas and palladium on charcoal.</p>Formula:C41H35NO2SPurity:Min. 95%Molecular weight:605.79 g/mol(D-Trp6)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13·xC2H4O2Purity:Min. 95%Molecular weight:1,311.45 g/molZ-Gly-Leu-NH2
CAS:<p>Z-Gly-Leu-NH2 is a synthetic peptide that has been designed to mimic the amino acid sequence of casein. It is a metalloendopeptidase inhibitor and can be used in the synthesis of proteins. Z-Gly-Leu-NH2 inhibits the activity of subtilisin, which is a proteolytic enzyme. The inhibition of subtilisin by Z-Gly-Leu-NH2 prevents the hydrolysis of peptide bonds in protein substrates. This inhibition leads to an increase in molecular weight and molecular weight distribution, as well as an increase in the number of high molecular weight peaks on chromatograms. This peptide also has serine protease inhibitory activity and can be used as a synthetic substrate for kinetic studies.</p>Formula:C16H23N3O4Purity:Min. 95%Molecular weight:321.37 g/molH-Arg-4MbetaNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Arg-4MbetaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O2·xHClPurity:Min. 95%Molecular weight:365.86 g/molL-Lysine acetate
CAS:Controlled Product<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>Formula:C8H18N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.24 g/molBoc-Phe-D-Leu-Phe-D-Leu-Phe-OH
CAS:<p>Polymyxin B is a cationic detergent that binds to bacterial membranes and destroys the cell wall. Polymyxin B has been shown to be a potent antagonist of spermatozoa and microglia, which are cells that maintain the homeostasis of the central nervous system. It also has been shown to be an inhibitor of chemotaxis in polymorphonuclear leucocytes (PMN), which are white blood cells that participate in inflammatory processes. Polymyxin B has been shown to have chemotactic activity for PMN and inhibit protein synthesis in mitochondria. This compound also inhibits chelerythrine, a cyclase inhibitor that is used as an antineoplastic agent.</p>Formula:C44H59N5O8Purity:Min. 95%Molecular weight:785.97 g/molCecropin B (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H301N51O42SPurity:Min. 95%Molecular weight:3,835.66 g/molH-D-Thr-OBzl·oxalate (1:1)
CAS:<p>Please enquire for more information about H-D-Thr-OBzl·oxalate (1:1) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15NO3·C2H2O4Purity:Min. 95%Molecular weight:299.28 g/molCarbamoyl-Asp-OH·magnesium salt/Carbamoyl-Asp-OH·dipotassium salt (1:1)
CAS:<p>Carbamoyl-Asp-OH·magnesium salt/Carbamoyl-Asp-OH·dipotassium salt (1:1) is a derivate of p-hydroxybenzoic acid that has been shown to inhibit leukotriene receptor antagonists and basic proteins. It has been found in urine samples, but its function is not yet known. The uptake of this molecule may be a potential biomarker for the diagnosis of orotic aciduria and HIV infection. Carbamoyl-Asp-OH·magnesium salt/Carbamoyl-Asp-OH·dipotassium salt (1:1) has also been shown to be an inhibitor of intramolecular hydrogen transfer reactions in model systems.</p>Formula:C10H12K2MgN4O10Purity:Min. 95%Molecular weight:450.72 g/molH-Ala-Met-OH
CAS:<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>Formula:C8H16N2O3SPurity:Min. 95%Molecular weight:220.29 g/molH-Pro-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O2·HClPurity:Min. 95%Molecular weight:297.78 g/molPyr-Gly-OH
CAS:<p>Pyr-Gly-OH is a metabolite of the amino acid glutamate. It has been shown that this metabolite is formed by a non-enzymatic dehydration of glutamate. This compound has been shown to be effective in treating bowel disease and cancer, as well as stimulating the production of fibrinogen in the blood. Pyr-Gly-OH has also been found to have anti-inflammatory effects and an increased effect on glutamic receptors.</p>Formula:C7H10N2O4Purity:Min. 95%Molecular weight:186.17 g/molH-Gly-Leu-Leu-Gly-OH
CAS:<p>Please enquire for more information about H-Gly-Leu-Leu-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N4O5Purity:Min. 95%Molecular weight:358.43 g/molTrt-Met-OH·DEA
CAS:<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H25NO2S·C4H11NPurity:Min. 95%Molecular weight:464.66 g/molHIV (gp120) Fragment (308-331)
CAS:<p>HIV is a type of virus that causes AIDS. HIV infects the cells of the human immune system, destroying them and making the body vulnerable to infections from other types of viruses and bacteria. The gp120 protein is an envelope glycoprotein that mediates binding to the CD4 receptor on host T-helper cells and induces fusion of viral and cellular membranes. The gp120 protein has been studied using a variety of methods, including neutralizing antibody binding experiments, enzyme-linked immunosorbent assays (ELISA), Western blotting, peptide mapping, and density lipoprotein binding assays. This fragment contains residues 308-331 in a human immunodeficiency virus (HIV) type 1 gp120 protein.</p>Formula:C114H199N41O31Purity:Min. 95%Molecular weight:2,640.06 g/mol2'-Methoxy-α-naphthoflavone
CAS:<p>2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.</p>Formula:C20H14O3Purity:Min. 95%Molecular weight:302.32 g/molHCV Core Protein (59-68)
CAS:<p>Please enquire for more information about HCV Core Protein (59-68) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H91N21O12Purity:Min. 95%Molecular weight:1,178.39 g/mol1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt)
CAS:<p>1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:(C2H4O)nC44H87N2O10P•H3NPurity:Min. 95%Color and Shape:White PowderG Protein Antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2
CAS:<p>G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2 is a synthetic peptide that inhibits the activity of cyclase enzymes. It has been shown to inhibit skin cancer cells and has been shown to bind intracellular targets, such as protein kinase C, with high affinity. G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp--Met--NH2 has also been shown to inhibit the guanine nucleotide binding proteins (G proteins), which are necessary for cell signaling. G protein antagonist Pyr--Gln--D--Trp--Phe--D--Trp--D---Trp---Met---NH2 may also be used as an inhibitor of neurokinin 1 receptor activation and whole cell recordings have shown this drug to be potent antagonists of α subunit. G protein antagonist Pyr--Gln--D</p>Formula:C57H64N12O9SPurity:Min. 95%Molecular weight:1,093.26 g/molH-Ser-Met-OH
CAS:<p>Glycyl-l-leucine is a muscle protein that belongs to the group of glycyl amino acids. It has been shown to have cortisone activity, which causes it to function as a suppressant. Glycyl-l-leucine binds to iron and prevents its oxidation, thereby preventing the formation of reactive oxygen species. Glycyl-l-leucine also has the ability to chelate iron, which can cause it to have antioxidant functions. The pH optimum for this compound is acidic and it is not active in neutral pH environments. This compound is found in fetal bovine serum and may be present in some food products such as chocolate milk or cheese. Glycyl-l-leucine may be used as an immobilizing agent for enzymes because it does not denature proteins at high concentrations.END></p>Formula:C8H16N2O4SPurity:Min. 95%Molecular weight:236.29 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS:<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H101N19O17Purity:Min. 95%Molecular weight:1,516.7 g/molMca-Arg-Pro-Lys-Pro-Gln-OH
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H56N10O11Purity:Min. 95%Molecular weight:840.92 g/molH-Arg-Tyr-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Tyr-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N6O3·2HClPurity:Min. 95%Molecular weight:409.31 g/molBoc-Gly-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Gly-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/molACTH (22-39)
CAS:<p>ACTH (22-39) H-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu is a modified form of ACTH (22-39) that is used for the treatment of diabetes mellitus. It is a synthetic peptide and has been shown to reduce body mass index, adipose tissue, and plasma glucose levels in diabetic patients. This drug also increases plasma cortisol concentrations and inhibits insulin production in pancreatic β cells.</p>Formula:C90H125N19O32Purity:Min. 95%Molecular weight:1,985.06 g/molAdrenomedullin (16-31) (human, pig)
CAS:<p>Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H129N25O21S2Purity:Min. 95%Molecular weight:1,865.19 g/molAdipokinetic Hormone (Apis mellifera ligustica) TFA salt
CAS:<p>Adipokinetic hormone is a peptide hormone that has been shown to stimulate the metabolism of fat cells in laboratory animals. This peptide is produced by the gland cells of honeybees and is used to regulate the energy metabolism of honeybees and other insects. Adipokinetic hormone has been shown to increase locomotor activity, inhibit the growth of human pathogens, activate transfer reactions, and inhibit receptor activity. The biological properties of this hormone have not yet been fully elucidated.</p>Formula:C47H65N11O14•C2HF3O2Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:1,122.10 g/molMethyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H16N2O3SPurity:85%MinMolecular weight:292.35 g/molH-Tyr-Thr-NH2 hydrochloride salt
CAS:<p>Please enquire for more information about H-Tyr-Thr-NH2 hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O4Purity:Min. 95%Molecular weight:281.31 g/molH-Leu-Val-Leu-Ala-pNA
CAS:<p>Please enquire for more information about H-Leu-Val-Leu-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H42N6O6Purity:Min. 95%Molecular weight:534.65 g/molFmoc-Nle-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Nle-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molFmoc-D-Leu-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Leu-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Cecropin A (1-8)-Melittin (1-18) amide
CAS:<p>Please enquire for more information about Cecropin A (1-8)-Melittin (1-18) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H233N33O29Purity:Min. 95%Molecular weight:2,794.51 g/molNocistatin (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O32Purity:Min. 95%Molecular weight:1,927.07 g/molGalanin (mouse, rat)
CAS:<p>Structure/Function: mouse, rat</p>Formula:C141H211N43O41Purity:Min. 95%Molecular weight:3,164.45 g/mol(D-Pen 2,p-chloro-Phe4,D-Pen 5)-Enkephalin
CAS:<p>D-Pen 2,p-chloro-Phe4,D-Pen 5)-Enkephalin H-Tyr-D-Pen-Gly-p-chloro-Phe-D-Pen (Disulfide bond) is a peptide that belongs to the family of opioid drugs. It has low potency and is used in pharmacological studies as a nonselective antagonist of δ-, μ-, and κ-(kappa) receptors. This drug blocks pain by binding to the same receptor sites that are activated by endogenous opioids and has been shown to be effective against both inflammatory and neuropathic pain. DPDPE has also been shown to have a high safety profile with minimal side effects.</p>Formula:C30H38ClN5O7S2Purity:Min. 95%Molecular weight:680.24 g/molEndomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molH-Asn-Pro-Glu-Tyr(PO3H2)-OH
CAS:<p>Please enquire for more information about H-Asn-Pro-Glu-Tyr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H32N5O12PPurity:Min. 95%Molecular weight:601.5 g/molRF9 trifluoroacetate salt
CAS:<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>Formula:C26H38N6O3Purity:Min. 95%Molecular weight:482.62 g/molpTH (1-31) amide (human)
CAS:<p>pTH (1-31) amide is a polymer conjugate that is used to treat osteoporosis. It has been shown to be effective in reducing the risk of fracture and increasing bone mineral density in animals. The compound binds to the extracellular domain of the estrogen receptor, altering its conformation and preventing it from interacting with other proteins in the nucleus. pTH (1-31) amide has also been shown to reduce blood pressure in animals by inhibiting angiotensin-converting enzyme. Clinical data on this drug are limited, but it has been well tolerated so far.</p>Formula:C162H270N50O46S2Purity:Min. 95%Molecular weight:3,718.32 g/molH-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Leu-Glu-Thr-Asp-AFC
CAS:<p>Please enquire for more information about Ac-Leu-Glu-Thr-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H38F3N5O12Purity:Min. 95%Molecular weight:729.66 g/molH-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Cionin
CAS:<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>Formula:C53H63N11O19S3Purity:Min. 95%Molecular weight:1,254.33 g/molBiotinyl-Tyr-Val-Ala-Asp-chloromethylketone
CAS:<p>Please enquire for more information about Biotinyl-Tyr-Val-Ala-Asp-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H45ClN6O9SPurity:Min. 95%Molecular weight:725.25 g/molH-Gly-Glu-Gly-OH trifluoroacetic acid
CAS:<p>H-Gly-Glu-Gly-OH trifluoroacetic acid is a dilute buffer solution of amino acids. It has been used to study the thermodynamic stability of polypeptides and their sensitivity to acidic conditions. Experiments have shown that H-Gly-Glu-Gly-OH trifluoroacetic acid is more stable than glycine, glutamic acid, histidine, aspartic acid, or aspartyl. This compound is an amino acid with a high concentration of glutamic acid.</p>Formula:C9H15N3O6•(CF3CO2H)xPurity:Min. 95%Molecular weight:261.23 g/molNFAT Inhibitor trifluoroacetate salt
CAS:<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>Formula:C75H118N20O22SPurity:Min. 95%Molecular weight:1,683.93 g/molAc-Ala-Ala-Ala-Ala-OMe
CAS:<p>Ac-Ala-Ala-Ala-Ala-OMe is a peptidase that hydrolyzes the ester bonds of the hydrophobic amino acid residues, such as alanine, valine, leucine, and isoleucine. This enzyme deacylates and releases these amino acids from the side chain of their corresponding fatty acyl groups. Ac-Ala-Ala-Ala-Ala-OMe also acts on N terminal and C terminal residues. The presence of a scissile bond in the peptide substrate is required for this enzyme to function. Acetylation reactions are concurrent with acylation reactions, which produce an acetylated peptide product.</p>Formula:C15H26N4O6Purity:Min. 95%Molecular weight:358.39 g/molpTH (44-68) (human)
CAS:<p>Please enquire for more information about pTH (44-68) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H199N41O41Purity:Min. 95%Molecular weight:2,836.08 g/molH-Arg-Phe-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N6O4Purity:Min. 95%Molecular weight:392.45 g/molMeOSuc-Ala-Ala-Pro-Ala-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone is a peptidyl substrate for the enzyme carboxypeptidase A. This substrate has a high specificity for carboxypeptidase A and does not bind to other enzymes such as carboxypeptidase B, D, or L. The hydrophobic nature of this substrate has been shown in both hamsters and macaques. MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone also shows cardiovascular effects in both animal models. It is possible that this effect is due to the proteolytic activity of the enzyme. More research needs to be done to identify the sequence of this peptide and how it may affect humans.</p>Formula:C20H31ClN4O7Purity:Min. 95%Molecular weight:474.94 g/molZ-Gly-Pro-Phe-Pro-Leu-OH
CAS:<p>Please enquire for more information about Z-Gly-Pro-Phe-Pro-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H45N5O8Purity:Min. 95%Molecular weight:663.76 g/mol5-Amino-2-methoxyisonicotinic acid
CAS:<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>Formula:C7H8N2O3Purity:Min. 95%Molecular weight:168.15 g/mol(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H286N54O56Purity:Min. 95%Molecular weight:4,222.63 g/molH-D-Ala-Gln-OH
CAS:<p>H-D-Ala-Gln-OH is a modified structural analog of l-fucose that has been shown to be a potent immunostimulant in vitro. The hydrocarbon chain on this molecule is substituted with an H-D-Ala moiety, which provides the molecule with a hydroxyl group. This modification increases the solubility of the molecule, thereby making it more suitable for in vivo administration. Additionally, modifications to the hydrocarbon chain may have functional consequences on the molecule's activity (e.g., substitutions may increase or decrease its ability to induce interleukin).</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molCaspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid)
CAS:<p>Caspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) is a peptide inhibitor of caspases. It blocks the activation of these proteases and their subsequent cleavage of substrates in the apoptotic pathway. This drug has potent inhibitory activity against caspases 3, 7, 8, 9, and 10. Caspase-3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) specifically interacts with the active site and inhibits the enzyme by binding to an aspartic acid residue at position D197 in human caspase 3. Caspase 3/7 Inhibitor II Ac-Asp-Asn-Leu-Asp-aldehyde (pseudo acid) is localized to mitochondria and binds to acetyldeviceine (acDEV), a substrate for caspases</p>Formula:C20H31N5O10Purity:Min. 95%Molecular weight:501.49 g/mol3-(2R,3S)-Phenylisoserine
CAS:<p>3-(2R,3S)-Phenylisoserine is a chiral enantiomer that can be used in organic synthesis. It is a reactive compound and has the ability to form amide bonds with other compounds. 3-(2R,3S)-Phenylisoserine is also able to react with nitro groups and form an oxime. It is not soluble in water but it is soluble in organic solvents like acetone or methanol. 3-(2R,3S)-Phenylisoserine can be synthesized by the enzymatic methods of benzyloxymethyl hydrazine and hydrochloric acid.</p>Formula:C9H11NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:181.19 g/molBoc-Gly-Gly-Leu-pNA
CAS:<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molBiotinyl-Angiotensin I/II (1-7) Biotinyl-Asp-Arg-Val-Tyr-Ile-His-Pro-OH
CAS:<p>Please enquire for more information about Biotinyl-Angiotensin I/II (1-7) Biotinyl-Asp-Arg-Val-Tyr-Ile-His-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H76N14O13SPurity:Min. 95%Molecular weight:1,125.3 g/mol1-t-Boc-piperidine-4-spiro-5'-[1',3'-bis-t-boc]-hydantoin
CAS:<p>Please enquire for more information about 1-t-Boc-piperidine-4-spiro-5'-[1',3'-bis-t-boc]-hydantoin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H35N3O8Purity:Min. 95%Molecular weight:469.53 g/molDnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS:<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>Formula:C38H57N15O11SPurity:Min. 95%Molecular weight:932.02 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(3,4-Dehydro-Pro3)-Tuftsin
CAS:<p>Please enquire for more information about (3,4-Dehydro-Pro3)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H38N8O6Purity:Min. 95%Molecular weight:498.58 g/molH-Val-Leu-Ser-Glu-Gly-OH
CAS:<p>H-Val-Leu-Ser-Glu-Gly-OH is a polypeptide that is hydrophobic and has carboxypeptidase activity. It hydrolyzes anions, such as the penicillin G, which has been shown to have a high affinity for this enzyme. H-Val-Leu-Ser-Glu-Gly-OH has also been shown to interact with other proteins through hydrophobic interactions. When used in high concentrations, it can be used to filter out substances that are hydrophobic. It can also be used to hydrolyze anions and divalent ions, such as copper and zinc.</p>Formula:C21H37N5O9Purity:Min. 95%Molecular weight:503.55 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/mol2-Isobutyl-3-methoxypyrazine
CAS:<p>2-Isobutyl-3-methoxypyrazine is a hydrophobic compound that is not soluble in water. It has a bound form and can be titrated with calorimetry. 2-Isobutyl-3-methoxypyrazine is synthesized by reacting 2,2,4-trimethylpentane with methoxyacetone in the presence of sodium methylate. The compound has been detected as an odorant in numerous plant species and is believed to play a role in plant physiology. 2-Isobutyl-3-methoxypyrazine has been shown to have potent antiviral activity against infectious diseases such as HIV, herpes simplex virus type 1 (HSV1), and varicella zoster virus (VZV). This specific antiviral activity may be due to its ability to bind fatty acids by hydrogen bonds, which may interfere with the synthesis of viral membranes.</p>Formula:C9H14N2OPurity:Min. 95%Molecular weight:166.22 g/molH-Val-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/molH-Ile-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Pro-Leu-Gly-OEt
CAS:<p>Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le</p>Formula:C23H33N3O6Purity:Min. 95%Molecular weight:447.52 g/molMCH-Gene-Overprinted-Polypeptide-14 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H132N22O18S3Purity:Min. 95%Molecular weight:1,786.24 g/molN-Methyl-1,2-phenylenediamine dihydrochloride
CAS:<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>Formula:C7H12Cl2N2Purity:Min. 95%Color and Shape:PowderMolecular weight:195.09 g/mol(Ala6,D-Trp8,L-alaninol15)-Galanin (1-15)
CAS:<p>Please enquire for more information about (Ala6,D-Trp8,L-alaninol15)-Galanin (1-15) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H114N20O18Purity:Min. 95%Molecular weight:1,655.9 g/molACTH (7-38) (human)
CAS:<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Formula:C167H257N47O46Purity:Min. 95%Molecular weight:3,659.12 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/molAc-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H162N20O26Purity:Min. 95%Molecular weight:2,000.42 g/molAMCA-Glu-Glu-Lys-Pro-Ile-Ser-Phe-Phe-Arg-Leu-Gly-Lys(biotinyl)-NH2
CAS:<p>Please enquire for more information about AMCA-Glu-Glu-Lys-Pro-Ile-Ser-Phe-Phe-Arg-Leu-Gly-Lys(biotinyl)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H131N21O22SPurity:Min. 95%Molecular weight:1,891.2 g/molH-Lys(Boc)-OH
CAS:<p>H-Lys(Boc)-OH is an ε-amino-protected lysine that plays a pivotal role in solution phase peptide synthesis. Strategically protected at the ε-amino group, it allows controlled peptide assembly, and it serves as intermediate for synthesizing β-peptides. The bulky Boc (tert-butyloxycarbonyl) group shields its epsilon amine (NH2) group, acting as a protective measure to prevent unwanted side reactions.</p>Formula:C11H22N2O4Color and Shape:White PowderMolecular weight:246.3 g/molPhenserine
CAS:<p>Phenserine is a natural drug that is an ester hydrochloride. It has been shown to be effective in the treatment of Alzheimer's disease in clinical trials. Phenserine has also been found to inhibit acetylcholinesterase, an enzyme that breaks down the neurotransmitter acetylcholine. This inhibition leads to increased levels of acetylcholine, which can improve cognitive function and reduce neuronal death. The mechanism of action for phenserine is unknown, but it may involve a change in iron homeostasis or other biochemical reactions. Phenserine has not been tested on humans; however, it has shown promising results in animal studies.</p>Formula:C20H23N3O2Purity:Min. 95%Molecular weight:337.42 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H54NO8PSi2Purity:Min. 95%Molecular weight:932.15 g/molPAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H45N7O8Purity:Min. 95%Molecular weight:667.75 g/mol(Trp7,β-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Trp7,beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H57N9O10SPurity:Min. 95%Molecular weight:868.01 g/molDL-Alanine ethyl ester hydrochloride
CAS:<p>DL-Alanine ethyl ester hydrochloride is a byproduct of the reaction between ethylene and amines. It can be produced through the addition of l-phenylalanine to acetonitrile. This compound is an organic ester that has been shown to have a variety of reactions with metal ions, such as aluminium, l-glutamic acid, and primary amines. The product can be used in thermodynamic data for reaction systems involving DL-alanine ethyl ester hydrochloride.</p>Formula:C5H11NO2·HClPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:153.61 g/molSar-Pro-OH
CAS:<p>Please enquire for more information about Sar-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O3Purity:Min. 95%Molecular weight:186.21 g/molHIV-1 gag Protein p24 (137-154)
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (137-154) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C92H158N26O26SPurity:Min. 95%Molecular weight:2,076.46 g/molH-Tyr-His-OH
CAS:<p>H-Tyr-His-OH is a trifluoroacetic acid derivative that is a histidine odorant. It can be used as a substitute for histidine in the detection of blood pressure, due to its ability to bind to nitric oxide and histidine receptors. H-Tyr-His-OH has been shown to have immunological properties, and it has been used as an immunogen in the production of monoclonal antibodies against human erythrocytes. H-Tyr-His-OH is also considered to be a potential biomarker because it can be detected by LC-MS/MS methods.</p>Formula:C15H18N4O4Purity:Min. 95%Molecular weight:318.33 g/molFmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H41N3O8Purity:Min. 95%Molecular weight:595.68 g/mol4-(Benzyloxy)-N,N-dimethyl-indole-3-glyoxylamide
CAS:<p>Please enquire for more information about 4-(Benzyloxy)-N,N-dimethyl-indole-3-glyoxylamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.36 g/mol(p-Iodo-Phe7)-ACTH (4-10)
CAS:<p>Please enquire for more information about (p-Iodo-Phe7)-ACTH (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H58IN13O10SPurity:Min. 95%Molecular weight:1,087.98 g/mol(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat)
CAS:<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H254N50O36Purity:Min. 95%Molecular weight:3,478.07 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molH-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt
CAS:<p>H-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt (KCTA) is a peptide that belongs to the group of thioneins and is characterized by a high content of lysine, cysteine and histidine residues. This peptide has been shown to be effective in treating subcutaneous tumors in mice. KCTA binds to metallothionein and gamma amino butyric acid (GABA), which are proteins that regulate energy metabolism in cells. KCTA has also been shown to have antimicrobial effects against human serum, which may be due to its ability to bind with thionein.</p>Formula:C22H41N7O8S3Purity:Min. 95%Molecular weight:627.8 g/molH-Lys(acetimidoyl)-OH
CAS:<p>Lysine acetimidate is a reactive compound that can be activated by the addition of an acid. Lysine acetimidate is a potent activator of macrophages and other inflammatory cells. It has been used in experimental models to study bowel disease and repair mechanisms. In these models, lysine acetimidate has shown to have anti-inflammatory effects, which may be due to its ability to decrease the production of pro-inflammatory cytokines by immune cells. The metabolic disorder caused by lysine acetimidate is still being studied. Lysine acetimidate also has immunomodulatory effects, as it can inhibit the synthesis of epidermal growth factor (EGF) in lung cells and cause damage to alveolar type II cells in the lung.</p>Formula:C8H17N3O2Purity:Min. 95%Molecular weight:187.24 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molGalanin (1-16) (mouse, porcine, rat)
CAS:<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H116N20O21Purity:Min. 95%Molecular weight:1,669.88 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>Formula:C61H87N17O14Purity:Min. 95%Molecular weight:1,282.45 g/molZ-Asp(OtBu)-ONp
CAS:<p>Please enquire for more information about Z-Asp(OtBu)-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H24N2O8Purity:Min. 95%Molecular weight:444.43 g/molH-Gly-Arg-Gly-Asp-OH
CAS:<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>Formula:C14H25N7O7Purity:Min. 95%Molecular weight:403.39 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molAc-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H43N10O12PPurity:Min. 95%Molecular weight:742.67 g/molPrion Protein (118-135) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H112N18O22S2Purity:Min. 95%Molecular weight:1,597.86 g/molMca-Pro-Leu-Gly-Pro-D-Lys(Dnp)-OH
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H52N8O14Purity:Min. 95%Molecular weight:892.91 g/molIL-6 (88-121) (human)
CAS:<p>Please enquire for more information about IL-6 (88-121) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C179H281N45O58SPurity:Min. 95%Molecular weight:4,023.48 g/molH-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/molBoc-Ala-Gly-OSu
CAS:<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O7Purity:Min. 95%Molecular weight:343.33 g/molAdipokinetic Hormone G (Gryllus bimaculatus)
CAS:<p>Adipokinetic hormone G is a peptide found in the hemolymph of Gryllus bimaculatus, a species of cricket. It has been shown to have anti-lipemic and antilipaemic effects in animal models. Adipokinetic hormone G can be detected by bioassay and matrix-assisted laser desorption/ionization (MALDI) mass spectrometry.</p>Formula:C43H57N11O12Purity:Min. 95%Molecular weight:919.98 g/mol4-Fluoro-2-methoxy-5-nitroaniline
CAS:<p>Intermediate in the synthesis of osimertinib (AZD9291)</p>Formula:C7H7FN2O3Purity:Min. 95%Molecular weight:186.14 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/mol(D-Arg1,D-Trp7·9,Leu11)-Substance P
CAS:<p>Substance P is a neuropeptide that is involved in the transmission of pain signals from the nerves to the brain. It also has been implicated in inflammatory and autoimmune diseases. Substance P is a potent agonist of the neurokinin-1 receptor, which causes an increase in intracellular calcium ion levels, leading to neuronal excitation. The release of substance P from nerve fibers can be blocked by administration of an analog (e.g., N-acetyl-D-Arg1,D-Trp7·9,Leu11)-substance P H-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu -Leu -NH2). This compound blocks the activation of substance P receptors with high affinity and specificity.</p>Formula:C75H108N20O13Purity:Min. 95%Molecular weight:1,497.79 g/molFmoc-D-Asn(Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asn(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H34N2O5Purity:Min. 95%Molecular weight:610.7 g/molBoc-Thr(Bzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Thr(Bzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Kisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molConantokin G (free acid)
CAS:<p>Please enquire for more information about Conantokin G (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H137N25O45Purity:Min. 95%Molecular weight:2,265.17 g/mol(d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H78N13O10S2Purity:Min. 95%Molecular weight:1,121.4 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS:<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N13O11Purity:Min. 95%Molecular weight:1,156.33 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/molH-Pro-Leu-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H26N4O5Purity:Min. 95%Molecular weight:342.39 g/molHIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (65-73) (isolates MAL/U455) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H79N11O14S2Purity:Min. 95%Molecular weight:1,050.3 g/molIGF-I (30-41)
CAS:<p>Please enquire for more information about IGF-I (30-41) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H83N19O19Purity:Min. 95%Molecular weight:1,266.32 g/mol3-(4-Methoxybenzoyl)acrylic acid
CAS:<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H10O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.19 g/mol4-Fluoro-2-methoxyaniline
CAS:<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/molH-Asp-Asp-Asp-OH
CAS:<p>H-Asp-Asp-Asp-OH is a peptide that has been shown to disrupt the cytosol and cause apoptosis. It can also induce proteolytic maturation and modulate autocatalytic functions. H-Asp-Asp-Asp-OH induces apoptosis by activating caspase 9 and caspase 3, which cleaves poly (ADP ribose) polymerase (PARP). This leads to DNA fragmentation, chromatin condensation, nuclear fragmentation, cell shrinkage, membrane blebbing, and nuclear pyknosis. H-Asp-Asp-Asp-OH binds to the regulatory domain of caspase 9 and prevents it from being activated. The peptide also activates caspase 8 by binding to its regulatory domain, which then activates caspases 3 and 7. H-Asp-Asp-Asp-OH also stimulates the release of granzyme B from cytot</p>Formula:C12H17N3O10Purity:Min. 95%Molecular weight:363.28 g/molFmoc-Homoarg (Z)2-OH
CAS:<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H38N4O8Purity:Min. 95%Molecular weight:678.73 g/molAc-Thr-Leu-Asn-Phe-OH
CAS:<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>Formula:C25H37N5O8Purity:Min. 95%Molecular weight:535.59 g/molAcetyl-Pepstatin Ac-Val-Val-Sta-Ala-Sta-OH
CAS:<p>Acetyl-Pepstatin is a protein data inhibitor that binds to the active site of enzymes, inhibiting their function. Acetyl-pepstatin has been shown to inhibit cathepsin D, chymotrypsin, and trypsin. It also inhibits the activity of proteases in the stomach and intestinal tract. Acetyl-Pepstatin is used as an anti-inflammatory drug for the treatment of chronic obstructive pulmonary disease (COPD) and congestive heart failure (CHF). The inhibition of these enzymes reduces inflammation by preventing the activation of inflammatory cytokines. It also prevents collagen from being degraded by proteases, which leads to decreased degradation of cartilage by chondrocytes. This drug's mechanism is similar to that of acetylsalicylic acid (aspirin), in that it inhibits prostaglandin synthesis.br></p>Formula:C31H57N5O9Purity:Min. 95%Molecular weight:643.81 g/molH-Phe-Val-OH
CAS:<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>Formula:C14H20N2O3Purity:Min. 98%Color and Shape:PowderMolecular weight:264.32 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molBoc-Phe-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%KALA Amphipathic Peptide
CAS:<p>Please enquire for more information about KALA Amphipathic Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H248N40O35SPurity:Min. 95%Molecular weight:3,131.82 g/molSplenopentin acetate salt
CAS:<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>Formula:C31H51N9O9Purity:Min. 95%Molecular weight:693.79 g/molH-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molFmoc-Val-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H34N2O7SPurity:Min. 95%Color and Shape:PowderMolecular weight:590.69 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molBiotinyl-Substance P trifluoroacetate salt
CAS:<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>Formula:C73H112N20O15S2Purity:Min. 95%Molecular weight:1,573.93 g/molH-Tyr-Trp-OH
CAS:<p>H-Tyr-Trp-OH is a synthetic, constant ligand for nuclear receptors. It has been shown to be active in the cerebral cortex, with a brain concentration of about 1 µM at steady state. This compound has been shown to be an agonist of the transcription factor nuclear receptor peroxisome proliferator-activated receptor alpha (PPARα) and can be used as a potential therapeutic agent for Alzheimer's disease. H-Tyr-Trp-OH has also been shown to enhance phosphorylation of the microtubule protein tau in cultured cortical neurons, which may have implications for the treatment of Parkinson's disease.</p>Formula:C20H21N3O4Purity:Min. 95%Molecular weight:367.4 g/molH-Phe-Pro-Ala-pNA
CAS:<p>Please enquire for more information about H-Phe-Pro-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27N5O5Purity:Min. 95%Molecular weight:453.49 g/molBoc-D-Arg(Pmc)-OH
CAS:<p>Boc-D-Arg(Pmc)-OH is a triazole derivative that inhibits the production of proinflammatory cytokines. It is used as a therapeutic for premature infants to reduce the risk of infections, such as sepsis and meningitis. Boc-D-Arg(Pmc)-OH has been shown to inhibit interleukin 1 receptor (IL1R) and IL1β synthesis in human cells. Boc-D-Arg(Pmc)-OH binds to the triazole ring of IL1β, preventing the formation of an enzyme complex that is required for IL1β synthesis. This binding also prevents the formation of an enzyme complex that is required for IL1R synthesis. The conformation of the peptide chain may be important for its activity, with some stereoisomers being more potent than others.</p>Formula:C25H40N4O7SPurity:Min. 95%Molecular weight:540.67 g/molBoc-Pro-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Met-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H47N9O8SPurity:Min. 95%Molecular weight:729.85 g/molH-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH
CAS:<p>Please enquire for more information about H-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H164N32O27SPurity:Min. 95%Molecular weight:2,530.86 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/molH-Tyr-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molH-Gly-Arg-pNA·2 HCl
CAS:<p>Please enquire for more information about H-Gly-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N7O4·2HClPurity:Min. 95%Molecular weight:424.28 g/molpTH (18-48) (human)
CAS:<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H251N47O43SPurity:Min. 95%Molecular weight:3,505.02 g/molFmoc-Glu(OtBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%BAM-3200
CAS:<p>BAM-3200 is a small molecule with the chemical formula CHFOC(O)NHCHCOOH. It is a potent and selective agonist of the TrkB receptor, which binds to brain-derived neurotrophic factor (BDNF). BAM-3200 has been shown to have anti-cancer activity in mouse tumor models, as well as increased locomotor activity and improved memory retention in mice. The biological function of BAM-3200 is not yet known. Structural analysis shows that it binds to the hydroxyl group on mammalian tissue receptors, which may be due to its basic protein structure. BAM-3200 also has been shown to hydrolyze enzymes such as esterases, glucuronidases, or glutathione reductase. This agent has been shown to be selectively active against cancer cells by binding to their acidic surface structures and altering their acidity.</p>Formula:C147H207N41O34S2Purity:Min. 95%Molecular weight:3,156.6 g/mol(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS:<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>Formula:C109H163N25O32SPurity:Min. 95%Molecular weight:2,367.68 g/molZ-Glu-Gly-OH
CAS:<p>Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.</p>Formula:C15H18N2O7Purity:Min. 95%Molecular weight:338.31 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H69N9O11SPurity:Min. 95%Molecular weight:920.13 g/mol(Ala92)-Peptide 6
CAS:<p>Please enquire for more information about (Ala92)-Peptide 6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H155N31O26Purity:Min. 95%Molecular weight:2,123.42 g/mol(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H107N25O19S2Purity:Min. 95%Molecular weight:1,594.82 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molAc-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH
CAS:<p>Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH is a nucleic acid sensor that can be used to detect the presence of specific nucleic acids (DNA or RNA) in a sample. Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH binds to nucleic acids, and then emits fluorescence when irradiated with light at a wavelength of 350 nm. Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH can be used as an assay for the detection of specific DNA sequences, such as those found in single nucleotide polymorphisms (SNPs).</p>Formula:C32H46N5O17PPurity:Min. 95%Molecular weight:803.7 g/molAc-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu-NH2
CAS:<p>The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.</p>Formula:C96H123N19O22Purity:Min. 95%Molecular weight:1,895.12 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/molH-Gln-Gly-OH
CAS:<p>H-Gln-Gly-OH is a proteolytic enzyme that cleaves peptide bonds in proteins. It is an enzyme that is involved in inflammatory diseases, as it has been shown to inhibit the production of messenger RNA (mRNA) and protein synthesis. H-Gln-Gly-OH also has anti-inflammatory properties. It has been shown to inhibit the production of amines from the amino acid arginine, which may be linked to its anti-inflammatory effects. This enzyme does not have a specific role in human metabolism and is found in human liver and other tissues. The structural analysis of this enzyme reveals that it contains a carbonyl group and an amide group with acidic properties. H-Gln-Gly-OH has been implicated in autoimmune diseases and infectious diseases, as it has been found in Streptococcus pyogenes, Mycoplasma pneumoniae, Borrelia burgdorferi, Coxiella burnetii</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/molH-Gln-Gly-Pro-OH·TFA
CAS:<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N4O5·C2HF3O2Purity:Min. 95%Molecular weight:414.33 g/molN-Et-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-Et-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H31N3O2Purity:Min. 95%Molecular weight:333.47 g/molH-Lys(isopropyl)-OH
CAS:<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H20N2O2Purity:Min. 95%Molecular weight:188.27 g/molH-Ala-His-OH
CAS:<p>H-Ala-His-OH is a dietary supplement that contains histidine and alanine. Histidine is an amino acid involved in protein synthesis, which is a process that produces proteins from amino acids. H-Ala-His-OH has shown to inhibit chemical reactions involving histidine, such as the conversion of histidine to urocanic acid by bacterial enzymes. The uptake of H-Ala-His-OH has been shown to be increased by creatine supplementation, which may be due to the ability of creatine to increase cellular energy levels. Magnetic resonance spectroscopy (MRS) analysis has shown that H-Ala-His-OH increases glutamine levels in the brain. This may be due to its ability to cross the blood brain barrier and affect glutamate transport through the blood brain barrier.</p>Formula:C9H14N4O3Purity:Min. 95%Molecular weight:226.23 g/molH-Ala-Ala-Lys-OH hydrochloride salt
CAS:<p>H-Ala-Ala-Lys-OH hydrochloride salt is a tripeptide with a reactive side chain. The protonated form of the molecule can be analyzed by acid analysis, and the ligand can be synthesized in a laboratory. Amino acid analysis has shown that this tripeptide contains lysine residues, which are important for binding to the peptide transporter. This compound is taken up through the intestine and is found in porcine tissue. H-Ala-Ala-Lys-OH hydrochloride salt has been used as a model compound in structural studies of peptide transporters.</p>Formula:C12H24N4O4Purity:Min. 95%Molecular weight:288.34 g/mol4-Bromo-2-methylthiophene
CAS:<p>4-Bromo-2-methylthiophene is a linker that is used in the synthesis of metal carbonyls. It has been shown to be an efficient cross-linking agent for the preparation of polymers. 4-Bromo-2-methylthiophene can be isomerized to 2,5-dimethylthiophene by heating it with hydroxylamine. 4-Bromo-2-methylthiophene can also catalyze the alkylation of nucleophiles such as ammonia and dimethyl sulfate, as well as nucleophilic attack on carboxylic acid derivatives. This compound is acidic, due to its chloride substituent, which can react with basic groups such as hydroxyl groups or amines.</p>Formula:C5H5BrSPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:177.06 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Nle 8·18,Tyr34)-pTH (3-34) amide (bovine)
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (3-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H279N53O48Purity:Min. 95%Molecular weight:3,917.44 g/molH-Glu-Val-Phe-OH
CAS:<p>H-Glu-Val-Phe-OH is a cytosolic protein that has been shown to react with a number of reactive oxygen species. It reacts with electrons by forming a disulfide bond, which can be reduced back to the original molecule by the addition of an electron donor. This chemical reaction may be important in radiation or chemical toxicity. H-Glu-Val-Phe-OH has been used as a monoclonal antibody in pharmacokinetic modeling and pharmacodynamic studies, and has been shown to have low clearance and high volume of distribution, suggesting that this protein is concentrated in the cytosol. H-Glu-Val-Phe-OH also has pharmacokinetic properties that are not well understood, but it is thought to be eliminated from the body at a rate similar to ornithine.</p>Formula:C19H27N3O6Purity:Min. 95%Molecular weight:393.43 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molL-Cystine dihydrochloride
CAS:<p>L-Cystine dihydrochloride is a chemical compound that is used as an amino acid. It has biological properties that are due to its ability to inhibit pancreatic lipase and l-threonine. L-Cystine dihydrochloride has been shown to have anti-infectious effects against a number of bacterial and viral diseases, including HIV, herpes simplex virus, and influenza. L-Cystine dihydrochloride is also used in cell culture experiments because it can be used to break disulfide bonds in proteins.</p>Formula:C6H14Cl2N2O4S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:313.22 g/molFmoc-Ile-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/mol(His(3-Me)2)-TRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-TRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H24N6O4Purity:Min. 95%Molecular weight:376.41 g/molFor-Phe-OMe
CAS:<p>Please enquire for more information about For-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H13NO3Purity:Min. 95%Molecular weight:207.23 g/molH-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H71N11O15S2Purity:Min. 95%Molecular weight:1,226.38 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/molH-Met-Thr-OH
CAS:<p>Met-Thr-OH is a peptide binding inhibitor that is used as a research tool for determining the role of metalloproteins in vivo. Methionine aminopeptidase (MetAP) is an enzyme that cleaves methionine from protein and peptides and has been shown to play a vital role in cancer progression. MetAP has been shown to be inhibited by Met-Thr-OH, which binds to the enzyme's active site and blocks its activity. The inhibition of MetAP limits the production of proteins involved in cell growth and proliferation, leading to reductions in tumor size. This inhibition may also be due to the inhibition of other functional groups such as phosphorylation, dephosphorylation, or nitrosylation.</p>Formula:C9H18N2O4SPurity:Min. 95%Molecular weight:250.32 g/mol(D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H106N22O12Purity:Min. 95%Molecular weight:1,375.67 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molH-D-Phe-D-Phe-OH
CAS:<p>H-D-Phe-D-Phe-OH is a polypeptide that contains 24 amino acids. It is synthesized by the filamentous fungus, Aspergillus niger, and has been found to be an optimal substrate for aminopeptidase. H-D-Phe-D-Phe-OH has also been shown to be a homolog of the halophilic enzyme from Halobacterium salinarum.</p>Formula:C18H20N2O3Purity:Min. 95%Molecular weight:312.36 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molToxic Shock Syndrome Toxin-1 (TSST-1) (58-78)
CAS:<p>Please enquire for more information about Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H171N33O35Purity:Min. 95%Molecular weight:2,371.61 g/mol([D2]Gly4)-Cholecystokinin Octapeptide (sulfated) ammonium salt
<p>Please enquire for more information about ([D2]Gly4)-Cholecystokinin Octapeptide (sulfated) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H60D2N10O16S3Purity:Min. 95%Molecular weight:1,145.28 g/mol
