Amino Acids (AA)

<p>Suc-Ala-Lys-Pro-Phe-pNA is a casein that has been modified to contain additional lysine residues. This modification increases the protein’s stability, making it more resistant to hydrolysis by phosphatases. Suc-Ala-Lys-Pro-Phe-pNA also contains a peptide sequence that is homologous to a part of the endoplasmic reticulum chaperone FK506 binding protein (FKBP). The peptide sequence in this casein acts as an artificial chaperone and can be used in cell culture experiments to stabilize newly synthesized proteins.</p>

<p>Please enquire for more information about Cell-permeable Caspase-3 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is a benzimidazole derivative. It has a chemical stability and can be used for wastewater treatment. It is also a pump inhibitor and can be used for anhydrous sodium magnesium salts. This product is synthesized from the reaction of protonated 2-bromo-4-methoxyphenol with 2,6-dimethylpyridine in the presence of hydrochloric acid. The reaction was carried out in an asymmetric synthesis using a proton transport system. 2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is soluble in water and has a pH of 1 to 3. It has been shown that this product can be used as an antioxidant and as a metal chelation agent.</p>

<p>Please enquire for more information about H-Pro-Leu-Gly-NHOH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin is a vasopressor analog that has been shown to be an effective treatment for congestive heart failure by acting as an agonist at the V1 receptor. It has been shown to stimulate cyclase activity and increase levels of adenosine 3',5'-cyclic monophosphate (cAMP). This drug also stimulates the production of immunoglobulin A antibodies in mice and increases the expression of leucine aminopeptidase and immunofluorescence in rat kidney cells. Vasopressin analogs are used primarily for their vasoconstrictive properties.</p>

<p>Hydrin 2 is a member of the family of peptide hormones that are involved in the regulation of blood pressure. It is synthesized from two amino acids, H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Arg-Gly-Gly-. Hydrin 2 has been shown to have biological properties that are similar to those of angiotensin II and vasopressin. This peptide hormone is produced as a result of the action of hydrochloric acid on the precursor peptide, which is synthesized in the ventral and apical regions of the bladder. The reaction product is soluble in water and has been shown to be effective at treating wastewater.</p>

<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Arg(Pbf)-allyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Phe-Leu-Phe-SBzl is a protease inhibitor that blocks the activity of serine proteases and inhibits protein synthesis. It has been shown to be active against a number of proteases, such as trypsin, chymotrypsin, elastase, and cathepsin G. Suc-Phe-Leu-Phe-SBzl has been reported to inhibit the activity of serine proteases at low concentrations but not at high concentrations. This drug also has a potent effect on cellular organelles such as mitochondria and lysosomes. The enzyme inhibition property of Suc-Phe-Leu-Phe-SBzl is due to its ability to bind strongly to proteins with hydrophobic amino acid residues in their active site.</p>

<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Trp-Glu-OH is a fatty acid that is involved in the synthesis of proteins. It is involved in the transcription-polymerase chain reaction, which is a technique used to amplify DNA sequences. H-Trp-Glu-OH is also used in sample preparation and in the treatment of neurological disorders and diabetes. H-Trp-Glu-OH has been shown to inhibit neuronal death by inhibiting uptake and cell proliferation through hydrogen bonds with human serum and peroxisome proliferation. This compound has also been shown to have diagnostic properties for diabetes, as it can be detected in human serum after an insulin stimulus.</p>

<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cholecystokinin-33 (10-20) (bovine, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Phe-Lys-OH is a synthetic peptide that mimics the lysine side chain of L-lysine. It has been shown to be cytotoxic to cancer cells and cardiac cells, with the formation rate of Ac-Phe-Lys-OH being dependent on the concentration of glycolaldehyde. The reaction yield for Ac-Phe-Lys-OH is also dependent on creatine kinase activity. Acetylation of Ac-Phe-Lys-OH reduces its cytotoxicity and increases its solubility in water.</p>

<p>AMC conjugated molecule targeting chymotrypsin-like peptidase, calpain I and II and papain, and Ti protease from E. coli</p>

<p>H-Gly-Cys-Gly-OH is an amino acid sequence that has been evaluated for its interactions with other amino acids and proteins. It is a tripeptide heterocycle and can be found in the tissues of many organisms, including humans. H-Gly-Cys-Gly-OH can be found in bovine serum and has been shown to have reversed phase high performance liquid chromatography activity. This molecule also interacts with reversed phase high performance liquid chromatography, ion exchange, and tripeptides.</p>

<p>Proadrenomedullin (1-20) is a polypeptide that is found in human plasma. It is a member of the vasoactive intestinal peptide family and has been shown to be involved in the regulation of vascular tone, blood pressure, and blood vessel permeability. Proadrenomedullin (1-20) also inhibits the production of proinflammatory cytokines such as tumor necrosis factor-alpha, interleukin-6, and interleukin-8. This compound has been shown to have antiviral activity against HIV and herpes simplex virus type 1. Proadrenomedullin (1-20) also functions as a growth factor for tumor cells.</p>

<p>CRF (6-33) is a neuropeptide that is found in the human cerebral cortex and rat liver. It has been shown to inhibit protein synthesis and sequenced by Edmond H. Fischer, who also discovered corticotropin-releasing factor (CRF). CRF (6-33) binds to its receptor CRFR1, which activates phospholipase C and generates inositol 1,4,5-triphosphate. This leads to the release of calcium from intracellular stores and the activation of protein kinase C. The release of calcium ions into the cytosol causes an increase in intracellular levels of cAMP, which activates a series of reactions responsible for the cellular effects of CRF. CRF (6-33) has been shown to be involved in depression by controlling neurotransmitter levels.br&gt;</p>

<p>Please enquire for more information about H-Lys-Asn-Asn-Gln-Lys-Ser-Glu-Pro-Leu-Ile-Gly-Arg-Lys-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Met-Gly-OH is an amide containing a sulfoxide group. It is synthesized from the amino acid glycine and the tripeptide Met-Gly-Gly. The synthesis of HMG was first reported by Sato in 1907, although it was not used as a drug until 1983. This drug has potential antitumor activity and inhibits the growth of certain tumor cells. HMG is metabolized by peptidases, which hydrolyze the peptide bond between glycine and Met-Gly-Gly. Hydrolysis of HMG yields glyoxylic acid (H2O2) and the amino acids glycine and methanol. HMG also inhibits the uptake of glucose into cells, which may be related to its antitumor effect. X-ray diffraction studies have shown that HMG has a carboxylate group at C6 that binds to three oxygen atoms, which are present in two</p>

<p>H-Gly-D-Gln-OH is a chiral molecule that has been used to identify the presence of cholinergic receptors in ventricular myocytes. It is a substrate for the enzyme acetylcholinesterase, which breaks down acetylcholine, an important neurotransmitter. H-Gly-D-Gln-OH binds to nicotinic and muscarinic acetylcholine receptor sites in cardiac muscle cells and can be detected in platelet membranes after injection. The dose of H-Gly-D-Gln-OH that is injected into mice will depend on the animal's weight.</p>

<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>

<p>Please enquire for more information about Mast Cell Degranulating (MCD) Peptide HR-1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Tyr-Ala-OH is a biochemical that is expressed in mammalian cells. It has been shown to activate enzymes and the production of proteins, which are essential for cell growth. Fmoc-Tyr-Ala-OH is also proteolytic and hydrolyzing, meaning it can be used to cleave proteins into smaller pieces. It has been shown to have acidic and neutral properties at different pH levels. This enzyme also has an inhibitory effect on the production of monoclonal antibodies in mcf-7 cells, which are derived from mouse mammary epithelial cells.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about PYX-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-His-Arg-Pro-OH acetate salt is a synthetic monoclonal antibody that binds to fibrinogen. It has been used in the production of a model protein and as an anticoagulant. H-Gly-His-Arg-Pro-OH acetate salt has been shown to inhibit the growth of tissue plasminogen activator, which is a growth factor for cells involved in blood clotting. This drug also inhibits the release of acetylcholine from nerve cells, which may be due to its ability to bind to plasma proteins.</p>

<p>3-Methylthiopropionic acid is a bacterial metabolite that can serve as an alternative carbon source for the production of amino acids. 3-Methylthiopropionic acid is used to study the effect of matrix on enzyme activities, and has been shown to have protein-binding properties. The compound also serves as a precursor in the synthesis of tiglic acid, which is a lysine precursor. 3-Methylthiopropionic acid has been found to be effective in slowing the growth of cancer cells. It has been shown to inhibit fatty acid synthesis, and may also inhibit methionine synthetase activity and cell proliferation.</p>

<p>Please enquire for more information about HCV NS4A Protein (22-34) (H strain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-p-phenyl-L-phenylalanine (FMPP) is a fluorescent probe that can be used to detect and diagnose damage in tissues. It is a small molecule that has been shown to bind to myocytes and cardiac tissues, specifically targeting skeletal and cardiac muscle. FMPP binds to the amino acid phenylalanine, which is found in high concentrations in cardiac tissue. This binding causes an increase in fluorescence, which can be detected by light microscopy or flow cytometry. FMPP has been used to detect damage in heart muscles of mice with dilated cardiomyopathy and also as a probe for myocardial infarctions in humans.</p>

<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt is a potent inhibitor of the enzyme kallikrein, which is involved in the production of kinins. It has been shown to inhibit bradykinin breakdown by inhibiting kallikrein and thus prolonging the effects of this hormone. Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt also inhibits aldosterone levels in plasma and reduces glucocorticoid levels, which may be due to its ability to inhibit plasma renin concentrations.</p>

<p>MeOSuc-Ala-Ala-Pro-Val-AMC is a serine protease inhibitor that has been shown to inhibit neutrophil elastase and human trypsin. It has been shown to be effective in the treatment of inflammatory diseases such as hepatitis, colitis, and Crohn's disease. MeOSuc-Ala-Ala-Pro-Val-AMC also inhibits coagulation and can be used as an anticoagulant. This drug is one of the few drugs that have been shown to inhibit both trypsin and elastase with equal potency.</p>

<p>Please enquire for more information about (Leu13-psi(CH2NH)Leu14)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cholecystokinin Octapeptide (2-8) (desulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Methylmorpholine is a protease inhibitor that has been shown to inhibit HIV-1 protease, a class of enzymes that are involved in the replication of HIV-1. It is used as a research tool to study the structure and function of HIV-1 protease. (R)-2-Methylmorpholine binds to the active site of the enzyme by forming hydrophobic interactions with residues in the active site. This binding leads to an inhibitory effect on ligand binding, protein synthesis, and other cellular processes. Molecular modeling studies have shown that (R)-2-Methylmorpholine inhibits HIV-1 protease by blocking the catalytic cleft and preventing access to substrate residues.</p>

<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Tyr-Ala-OH is a hydrophobic, reactive molecule that has been shown to be unstable in the presence of light and air. This compound is synthesized by the sequence: Gly-Tyr-Ala. It has been found to be an exciplex with the photooxidation product, 2-aminoacetophenone. The molecular weight of H-Gly-Tyr-Ala-OH is constant and can be determined by electrospray mass spectrometry. This molecule has shown to have a strong interaction with ovary tissue and can also produce carboxylate ions in solution.</p>

<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N,N'-Methylenediacrylamide is a water-soluble compound that has been used as a fluorescent probe for hydrogen bonding. It has been shown to have different phase transition temperatures in different solvents and can be used as an experimental model for studying the effects of temperature on the behavior of water molecules. N,N'-Methylenediacrylamide reacts with hydrochloric acid to form the fatty acid N,N'-methylenebis(3-chloroacrylic acid) under acidic conditions. This reaction is reversible, and the reverse process can be catalyzed by sodium citrate or human serum. When exposed to radiation or surface methodology, it emits light at a wavelength of 350 nm.</p>

<p>H-Phe-Gly-Phe-Gly-OH is a neutral, uv absorbing molecule. It can be found as a tetrapeptide sequence and in the form of isomers. H-Phe-Gly-Phe-Gly-OH is also known as Ileahexocin. The chemical ionization and matrix assisted laser desorption/ionization techniques have been used to detect this molecule in different matrices. H-Phe-Gly-Phe-Gly-OH has been shown to inhibit fatty acid synthesis, which may be due to its inhibition of the enzyme acetyl coenzyme A carboxylase (ACC). This molecule has also been shown to inhibit tripeptide synthesis, which may be due to its inhibition of the enzyme dipeptidyl peptidase IV (DPIV).</p>

<p>Suc-Phe-Pro-Phe-pNA is a peptide that has been shown to inhibit the effector functions of anisopliae. The molecule is synthesized by attaching a chloromethyl ketone to the carboxy terminal amino acid. This process is specific for only one sequence and can be used in metarhizium, which is a fungus that naturally occurs in soil and decomposing organic matter. Suc-Phe-Pro-Phe-pNA has been shown to be reactive with inflammatory diseases such as asthma, arthritis, and atherosclerosis. The molecule's activity may be due to its acidic nature or high salt content at its reactive site. This peptide also has a pH optimum range of 3–5, which may contribute to its activity as well.</p>

<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>

<p>Please enquire for more information about Ac-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-(Gln1)-Gastrin I (human) Biotinyl-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Arg-Arg-Pro-Phe-His-Sta-Ile-His-Lys(Boc)-OMe is an angiotensin II analogue that is used for the treatment of blood disorders. It inhibits angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II from angiotensin I. ACE inhibitors are also used to treat diseases such as glomerular dysfunction, congestive heart failure, high blood pressure, and cirrhosis. In addition, it has been shown to be effective in treating cardiovascular diseases such as hypertension and heart disease. ZARAPROHES is a synthetic substrate for nitrosation reactions and can be used to produce monoclonal antibodies against ACE.</p>

<p>Bz-Asn-pNA is a peptide that is synthesized by the enzyme phosphoenolpyruvate carboxykinase. It has been shown to be an effective inhibitor of proteolytic enzymes, such as aminopeptidases. Bz-Asn-pNA has also been shown to be stable in high salt concentrations and its activity does not change at physiological pH levels. The kinetic constants for Bz-Asn-pNA have been determined using dodecylphosphocholine and endogenous substrate (3H)lysine. The optimum pH for Bz-Asn-pNA is between 7 and 8, which is optimal for protein synthesis.</p>

<p>Please enquire for more information about Acetyl-(Cys(Acm)33·42)-EGF (33-42) amide (mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Annexin A1 (1-11) is a peptide that is part of the annexin family. It is involved in the degranulation of cells and inhibits inflammation by inhibiting the production of pro-inflammatory cytokines. Annexin A1 (1-11) has been shown to be an anti-inflammatory compound as it binds to phospholipids on the surface of neutrophils, leading to inhibition of their chemotaxis and phagocytosis. This peptide also interacts with other annexins and prevents apoptosis by blocking caspase activity. Finally, it has been found that annexin A1 (1-11) can promote the healing of wounds in mice by accelerating reepithelialization and reducing scar formation. The concentration required for these effects are nanomolar concentrations.</p>

<p>Please enquire for more information about Fmoc-L-Sec(phenyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH is a peptide that has been shown to have chemotactic activity for monocytes and polymorphonuclear leucocytes, which are cells that participate in the inflammatory response. It also has biological properties that are reactive with hydroxyl groups and can be used to generate monoclonal antibodies. H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH has been shown to stimulate the migration of galleria mellonella larvae, suggesting it may have potential as an antiinflammatory agent.</p>

<p>Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 is an opioid receptor agonist with a high affinity for the μ-, δ-, and κ-opioid receptors. Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 binds to these receptors, thereby inhibiting the release of neurotransmitters that transmit pain signals from the peripheral nerves to the brain. Acetyl fentanyl also inhibits the binding of opioid receptor antagonists such as naloxone, which is used in emergency rooms to block or reverse the effects of opioids. Acetyl fentanyl has been shown to be an effective analgesic in animal studies.</p>

<p>Fmoc-4-(Boc-amino)-L-phenylalanine is a useful building block, which is used in the synthesis of complex compounds and research chemicals. It is also a reaction component in the synthesis of compounds. Fmoc-4-(Boc-amino)-L-phenylalanine has CAS No. 174132-31-1 and can be used as a versatile building block to produce high quality reagents.</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>

<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-(4-Acetylphenyl)-2-methyl-1-propanone (AMP) is a synthetic analgesic that has been evaluated for the treatment of pain. It is primarily used in pharmaceuticals and medicinal preparations, as well as being a common solvent in chemical syntheses. AMP has been shown to be an effective treatment for joint pain, muscle pain, and other types of pain. The mechanism of action for this compound is unknown but may involve the inhibition of an enzyme called hydratropic acid group. This molecule also has a carboxylic acid group that undergoes detoxification through elemental analysis or mechanochemistry.</p>

<p>Please enquire for more information about (2S,4R)-Fmoc-Mpt(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>

<p>Please enquire for more information about N,N'-Ethane-1,2-diylidenebis(2-methylpropan-2-amine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.</p>

<p>H-Asp-Trp-OH is a peptide that has been shown to have antioxidative activity and neuroprotective effects. It has also been shown to be a reactive compound that can interact with other molecules, such as thiobarbituric acid. H-Asp-Trp-OH has been shown to increase the number of neurons in the brain and may be helpful in reducing neuronal damage by apoptotic cell death. This peptide also has potential use in treating neurodegenerative diseases, such as Alzheimer's disease.</p>

<p>Please enquire for more information about Leptin (93-105) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>

<p>Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-N-Me-D-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>

<p>Please enquire for more information about Fmoc-Asp(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Fm)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>

<p>Please enquire for more information about HIV-1 gag Protein p24 (194-210) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Threonine is an amino acid that belongs to the branched-chain family of amino acids. It is a nonessential amino acid, meaning that it can be synthesized by the human body. L-Threonine is one of the two amino acids (along with L-Serine) that has a hydroxyl group on the alpha carbon atom. It is also used in certain metabolic pathways such as sphingolipid metabolism and tryptophan metabolism. L-Threonine is used in experimental models for bowel disease and intestinal cancer, but its role in these conditions has not been determined. The molecule can be found in both animal and plant proteins, but most often it occurs in animal sources. The compound can also be found as a component of skin condition treatments or as an additive to shampoos, lotions, and cosmetics.</p>