
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,461 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38244 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H252N44O48S•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,652.1 g/molHel 13-5 trifluoroacetate salt
CAS:Controlled Product<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formula:C113H204N24O19Purity:Min. 95%Molecular weight:2,202.98 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H85FN16O13Purity:Min. 95%Molecular weight:1,365.51 g/molH-Asp-Gly-OH
CAS:<p>H-Asp-Gly-OH is a peptide hormone that belongs to the group of hydroxylated aspartic acid. This peptide hormone has been shown to be a lymphocyte transformation factor in vitro and stimulates the production of collagen and other proteins. It has also been shown to have anticarcinogenic effects on bone cancer cells, which may be due to its ability to induce apoptosis. H-Asp-Gly-OH has a neutral pH and forms stable complexes with metal ions, such as copper and zinc, which are important for a variety of biological functions.</p>Formula:C6H10N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:190.15 g/mol1-O-Octadecyl-sn-glycerol
CAS:<p>1-O-Octadecyl-sn-glycerol (1ODG) is a dietary lipid that is absorbed by the gastrointestinal tract and transported to the liver. It is used in cell culture as a substitute for lipids that are not available or cannot be used for experiments. 1ODG is also found in human lung and colon tissues, where it may act as a growth factor. 1ODG has been shown to inhibit herpes simplex virus type I (HSV-1) replication in cultured cells by increasing intracellular calcium levels and inhibiting viral DNA synthesis. It can also increase fatty acid synthesis and induce cellular proliferation of tissue culture cells, such as lung fibroblasts.</p>Formula:C21H44O3Purity:Min. 95%Molecular weight:344.57 g/molH-β-Ala-Trp-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H17N3O3Purity:Min. 95%Molecular weight:275.3 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H41N9O8Purity:Min. 95%Molecular weight:619.67 g/molH-Leu-Trp-Met-Arg-OH
CAS:<p>Histidine is a non-essential amino acid that is found in all living cells. It is a precursor of histamine and can be converted to tryptophan by decarboxylation. Histidine has been found to be essential for growth in some bacteria and yeast, but not in higher plants or animals. The formyl group of histidine can be oxidized to a sulfoxide or reduced to a formyl group. Histidine residues are often found in the protein matrix of proteomic samples, but can also be used as an analyte. The two most common methods for the detection of histidine are matrix-assisted laser desorption/ionization mass spectrometry (MALDI MS) and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI TOF MS). These methods allow for the minimization of background interference from other molecules present in the sample, such as tryptophan residues.</p>Formula:C28H44N8O5SPurity:Min. 95%Molecular weight:604.77 g/mol(Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molBoc-Ala-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ala-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Gly-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Gly-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-Thr-OH hydrochloride salt
CAS:<p>H-Lys-Thr-OH hydrochloride salt is a synthetic amino acid that has been used in the synthesis of a cyclic peptide. The synthesis was achieved by metathesis reactions, which involved the reaction of an acid chloride with a chiral amine to form an ester. H-Lys-Thr-OH hydrochloride salt has been shown to have high binding constants to its targets and can be used as a selective reagent for the synthesis of virus proteins. It is also able to bind to carboxylate groups, which are common in wild type viruses and gene products. This reagent also has cleavage products, which can be used for efficient method for synthesizing cyclic peptides.</p>Formula:C10H21N3O4Purity:Min. 95%Molecular weight:247.29 g/molH-Lys-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N6O5Purity:Min. 95%Molecular weight:478.59 g/molType B Allatostatin
CAS:<p>Allatostatin is a type of allatotropin. Allatotropins are a family of neuropeptides that inhibit the release of other hormones, such as vitellogenin, which is a hormone that stimulates vitellogenesis in insect ovaries. Allatostatin inhibits the release of vitellogenin by binding to the receptor on the egg follicle cells and blocking its action. This drug has been shown to be effective at inhibiting mevalonate production in rat ganglia and is also found in high concentrations in holometabolous insects. It is synthesized from an amide precursor by a series of enzymatic reactions and can be desorbed from its storage site with mild acidification.</p>Formula:C104H150N24O27Purity:Min. 95%Molecular weight:2,168.45 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/molH-Arg-Pro-pNA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O4Purity:Min. 95%Molecular weight:391.43 g/molL-Prolinamide
CAS:<p>Intermediate in the synthesis of vildagliptin</p>Formula:C5H10N2OPurity:Min. 95%Color and Shape:PowderMolecular weight:114.15 g/molGalanin (mouse, rat)
CAS:<p>Structure/Function: mouse, rat</p>Formula:C141H211N43O41Purity:Min. 95%Molecular weight:3,164.45 g/molH-D-Glu(Trp-OH)-OH
CAS:<p>H-D-Glu(Trp-OH)-OH is a synthetic peptide that has been shown to inhibit the replication of the herpes simplex virus (HSV). It binds to toll-like receptor 3 and 4 on cells, which may inhibit HSV replication. This compound has also been shown to be a potent inhibitor of HIV, as well as hepatitis B and C. H-D-Glu(Trp-OH)-OH has been shown to cause lung damage in mice. The mechanism for this effect is unknown, but it may involve an increase in reactive oxygen species or other cell signaling pathways.</p>Formula:C16H19N3O5Purity:Min. 95%Molecular weight:333.34 g/molZ-Arg-p-nitrobenzyl ester mixture of hydrochloride and hydrobromide salt
CAS:<p>Please enquire for more information about Z-Arg-p-nitrobenzyl ester mixture of hydrochloride and hydrobromide salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H25N5O6Purity:Min. 95%Molecular weight:443.45 g/mol12-(Boc-aminooxy)-dodecanoic acid
CAS:<p>Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H33NO5Purity:Min. 95%Molecular weight:331.45 g/molBoc-Ala-Ala-Asp-pNA
CAS:<p>Boc-Ala-Ala-Asp-pNA is a peptide that has been shown to have cytotoxic activity against the leukemia cell line, basophilic leukemia (BL). It also inhibits hemolytic activity and cytolysin production by staphylococcus. This peptide is expressed in the sequence of Boc-Ala-Ala-Asp and is composed of 20 amino acids. The Boc-Ala sequence has been shown to be involved in apoptosis, while Asp and pNA are responsible for inhibiting hemolytic activity. Functional assays have demonstrated that this peptide has a strong inhibitory effect on the growth of bacteria, including strains of subtilis and hybridization.</p>Formula:C21H29N5O9Purity:Min. 95%Molecular weight:495.48 g/molFmoc-Lys(Boc)-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H45N3O9SPurity:Min. 95%Molecular weight:719.84 g/molGlutaryl-Phe-bNA
CAS:<p>Please enquire for more information about Glutaryl-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H24N2O4Purity:Min. 99 Area-%Molecular weight:404.46 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS:<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>Formula:C52H77N17O14Purity:Min. 95%Molecular weight:1,164.27 g/molH-Lys-Ser-OH·HCl
CAS:<p>Please enquire for more information about H-Lys-Ser-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N3O4·HClPurity:Min. 95%Molecular weight:269.73 g/molH-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH
CAS:<p>H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH is a synthetic peptide that has been shown to inhibit the production of angiotensin and angiotensinogen by interfering with the binding of its receptor. It has also been shown to inhibit the production of proinflammatory cytokines, such as tumor necrosis factor alpha (TNFα), interleukin 1beta (IL1β), and IL6, in human macrophages. HAVY can also inhibit toll like receptor 4 mediated inflammatory responses in vivo. HAVY is an inhibitor of angiotensin II type 1 receptor activity, which may be useful in treating cardiovascular diseases such as atherosclerotic lesions, hypertension, and bowel disease.</p>Formula:C85H123N21O20Purity:Min. 95%Molecular weight:1,759.02 g/molH-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH
CAS:<p>Please enquire for more information about H-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H164N32O27SPurity:Min. 95%Molecular weight:2,530.86 g/molFmoc-Gln(Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Gln(Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Bzl-Nle-OH
CAS:<p>Please enquire for more information about Bzl-Nle-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19NO2Purity:Min. 95%Molecular weight:221.3 g/molFibronectin Adhesion-Promoting Peptide trifluoroacetate salt
CAS:<p>Fibronectin Adhesion-Promoting Peptide trifluoroacetate salt H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH trifluoroacetate salt (FAP) is a synthetic peptide that promotes fibronectin adhesion. It binds to the amino acid sequence in the C terminal end of fibronectin, which is known to be responsible for binding to actin filaments and growth factors. FAP has been shown to promote wound healing by stimulating the proliferation of corneal epithelial cells in vitro. The mechanism of action of FAP may be due to its ability to bind to chloride ions, which are involved in the regulation of cell proliferation and migration.</p>Formula:C47H74N16O10Purity:Min. 95%Molecular weight:1,023.19 g/molDiphenyl(4-phenylthio)phenylsufonium hexafluorophosphate
CAS:<p>Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate is a photoinitiator that is used in photopolymerization. It absorbs light at around 800 nm and emits light at around 810 nm. The initiator has a low molecular weight and is soluble in organic solvents, which makes it suitable for polymerization of acrylate monomers. Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate can be synthesized by the reaction of diphenyliodonium hexafluorophosphate with phenyldithiocarbonyl chloride.</p>Formula:C24H19S2•PF6Purity:Min. 95%Color and Shape:PowderMolecular weight:516.5 g/mol(Ala2)-Leu-Enkephalin
CAS:<p>Leu-enkephalin is an opioid peptide that is a neurotransmitter in the brain. It is synthesized from the proenkephalin precursor and acts on δ-opioid receptors and kappa-opioid receptors. Leu-enkephalin has been shown to have physiological effects such as analgesia, hypothermia, hyperalgesia, and decreased gastrointestinal motility. Leu-enkephalin also inhibits voltage-dependent calcium channels in neuronal cells by binding to them with high affinity. The binding of leu-enkephalin to these channels affects their function and leads to neuronal death. Disulfide bonds are formed between cysteine residues on leu-enkephalin to stabilize this protein's structure.</p>Formula:C29H39N5O7Purity:Min. 95%Molecular weight:569.65 g/molGlucagon (19-29) (human, rat, porcine) trifluoroacetate salt
CAS:<p>Glucagon is a peptide hormone that belongs to the group of vasoactive intestinal peptides. It is produced by the alpha cells of the pancreas and stimulates gluconeogenesis in the liver, thereby increasing blood glucose levels. Glucagon has also been shown to cause membrane hyperpolarization and cell death in cancer cells. Glucagon is a homologous protein that has been shown to have physiological effects similar to those of insulin, such as increased levels of cytosolic Ca2+ ions and camp levels. Glucagon binds to its receptor on the plasma membrane with high affinity, activating adenylate cyclase and phospholipase C, which leads to an increase in intracellular camp levels. This results in activation of protein kinase A (PKA), which phosphorylates proteins involved in glycogenolysis, glycolysis, and lipolysis. Glucagon also activates mitogen-activated protein kinases (MAPK</p>Formula:C61H89N15O18SPurity:Min. 95%Molecular weight:1,352.52 g/molAc-Ser-Asp-Lys-Pro-OH
CAS:<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Formula:C20H33N5O9Purity:Min. 95%Molecular weight:487.5 g/mol4-[4-(4-Methyloxy-phenyl)-piperazin-1-yl]-phenylamine
CAS:<p>4-Methyloxy-phenyl)-piperazin-1-yl]-phenylamine is an organic compound that has a reactive silicon group. It contains two phenyl groups, one of which is attached to the silicon. This compound exhibits phase equilibrium in water and can be used as a monomer for fabricating inorganic materials with orderly patterns, such as glass and metal oxides. This product also has impurities and can be grown at different rates depending on the conditions, such as temperature. The optical properties of 4-methyloxy-phenyl)-piperazin-1-yl]-phenylamine are dependent on its environment and it has been shown to have exothermic properties when reacting with iron powder.</p>Formula:C17H21N3OPurity:Min. 95%Molecular weight:283.37 g/molApelin-36 (1-16) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Apelin-36 (1-16) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H117N27O20Purity:Min. 95%Molecular weight:1,704.89 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H293N53O48S2Purity:Min. 95%Molecular weight:4,007.69 g/molMca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H89N17O17Purity:Min. 95%Molecular weight:1,332.46 g/molACTH (1-39) (guinea pig)
CAS:<p>Please enquire for more information about ACTH (1-39) (guinea pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C206H308N56O58SPurity:Min. 95%Molecular weight:4,529.06 g/mol2-Bromo-5-hydroxy-4-methoxybenzaldehyde
CAS:<p>2-Bromo-5-hydroxy-4-methoxybenzaldehyde is a death pathway inhibitor that has been shown to have radiosensitizing effects in vitro. It has also been found to inhibit the expression of matrix metalloproteinase (MMP) in human glioma cells and in a rat model of cerebral ischemia. This compound may be used as a potential chemotherapeutic agent for the treatment of cancer. 2-Bromo-5-hydroxy-4-methoxybenzaldehyde inhibits cell proliferation by inducing apoptosis, or programmed cell death, which may be due to its ability to suppress MMP activity.</p>Formula:C8H7BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:231.04 g/molH-Arg(Pmc)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Arg(Pmc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Allatotropin
CAS:<p>Allatotropin is a diagnostic agent that belongs to the class of antimicrobial peptides. It has been shown to have strong activity against Gram-positive and Gram-negative bacteria. Allatotropin inhibits the growth of bacteria by binding to the external membrane, disrupting its integrity. Allatotropin also has been shown to increase gamma-aminobutyric acid levels in brain tissue and galleria mellonella larvae when injected subcutaneously. This may be due to its ability to activate GABA receptors. Allatotropin can be synthesized in vitro by combining β-amino acids with fatty acids and terminal residues, such as lysine, arginine, and glutamine, under conditions that mimic those found in living cells. This synthetic process yields a mixture of allatotropins with varying chain lengths and amino acid sequences.</p>Formula:C65H103N19O17S2Purity:Min. 95%Molecular weight:1,486.76 g/molFmoc-Val-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H34N2O7SPurity:Min. 95%Color and Shape:PowderMolecular weight:590.69 g/molAc-DL-Lys(Ac)-OH
CAS:<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O4Purity:Min. 95%Molecular weight:230.26 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23IN4O4Purity:Min. 95%Molecular weight:534.35 g/molBiotinyl-ε-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone
CAS:<p>Please enquire for more information about Biotinyl-epsilon-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56ClN9O6SPurity:Min. 95%Molecular weight:790.42 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/molZ-His-Gly-OH
CAS:<p>Please enquire for more information about Z-His-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molAc-Gly-Arg-Gly-NH2
CAS:<p>Please enquire for more information about Ac-Gly-Arg-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23N7O4Purity:Min. 95%Molecular weight:329.36 g/molH-Gly-His-Arg-Pro-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N10O4Purity:Min. 95%Molecular weight:464.52 g/molFmoc-α-Me-Lys(Boc)-OH
CAS:<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>Formula:C27H34N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:482.57 g/molPz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt
CAS:<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>Formula:C38H52N10O8Purity:Min. 95%Molecular weight:776.88 g/molFmoc-His(1-Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-His(1-Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt
CAS:<p>Please enquire for more information about DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H91N15O21SPurity:Min. 95%Molecular weight:1,522.64 g/molH-Gly-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·HClPurity:Min. 95%Molecular weight:257.72 g/mol(S,S)-(-)-Bis(a-methylbenzyl)amine Hcl
CAS:<p>Please enquire for more information about (S,S)-(-)-Bis(a-methylbenzyl)amine Hcl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H19N·HClPurity:Min. 95%Molecular weight:261.79 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/mol(R)-1-Boc-3-Aminopyrrolidine
CAS:<p>(R)-1-Boc-3-Aminopyrrolidine is a small molecule that inhibits 3-kinase. It has been shown to bind to the ATP binding site of PI3Kδ and inhibit its activity. This results in the inhibition of phosphoinositide production, which leads to decreased cell proliferation and survival. (R)-1-Boc-3-Aminopyrrolidine has also been shown to have selectivity for isoform α over β, γ, and δ. The drug binds specifically to the ATP binding site on PI3Kδ, but does not disrupt other interactions such as hydrogen bonding or pi stacking interactions with residues in the vicinity of the ATP binding site. The IC50 values for (R)-1-Boc-3-Aminopyrrolidine were determined using siRNA knockdown experiments against human isoform α PI3Kδ.</p>Formula:C9H18N2O2Purity:Min. 95%Molecular weight:186.25 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H228N38O51Purity:Min. 95%Molecular weight:3,259.53 g/molpTH (28-48) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H150N28O29Purity:Min. 95%Molecular weight:2,148.38 g/molpTH (73-84) (human)
CAS:<p>Please enquire for more information about pTH (73-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H96N16O19Purity:Min. 95%Molecular weight:1,273.44 g/molH-Lys-Gly-Trp-Lys-OtBu acetate salt
CAS:<p>The acetate salt of H-Lys-Gly-Trp-Lys is a peptide that has been modified with an acetyl group. The acetate salt is neutral and does not react with other compounds. This compound is a superoxide scavenger and can be used to prevent the formation of reactive oxygen species in biological systems.</p>Formula:C29H47N7O5Purity:Min. 95%Molecular weight:573.73 g/mol1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid
CAS:<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H35FN2O7Purity:Min. 95%Molecular weight:590.64 g/mol((R)-4-Hydroxy-4-methyl-Orn (5-TAMRA)7)-Phalloidin
<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (5-TAMRA)7)-Phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H69N11O14SPurity:Min. 95%Molecular weight:1,200.32 g/molAc-Arg-Phe-Met-Trp-Met-Lys-NH2 TFA salt
CAS:<p>Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 is an opioid receptor agonist with a high affinity for the μ-, δ-, and κ-opioid receptors. Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 binds to these receptors, thereby inhibiting the release of neurotransmitters that transmit pain signals from the peripheral nerves to the brain. Acetyl fentanyl also inhibits the binding of opioid receptor antagonists such as naloxone, which is used in emergency rooms to block or reverse the effects of opioids. Acetyl fentanyl has been shown to be an effective analgesic in animal studies.</p>Formula:C44H66N12O7S2•xC2HF3O2Purity:Min. 95%Molecular weight:939.2 g/molL-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide
CAS:<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>Formula:C19H31N3O6Purity:Min. 95%Molecular weight:397.47 g/molCarboxymethyl-Phe-Leu-OH
CAS:<p>Carboxymethyl-Phe-Leu-OH (CMPLE) is a metalloprotease inhibitor that inhibits the activity of proteases, such as serine proteases and cysteine proteases. CMPLE is used to treat infectious diseases caused by bacteria, fungi, or parasites. CMPLE also has been shown to inhibit the formation of inflammatory responses in autoimmune and inflammatory diseases. This drug can be used in combination with benzalkonium chloride or monoclonal antibodies to treat hematopoietic cells. The optimum pH for this drug is 7.5, and it denatures at high temperatures. It also binds to epithelial surface glycoproteins in the gastrointestinal tract and may be useful for treating ulcers caused by Helicobacter pylori infection.</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H36N2O9Purity:Min. 95%Molecular weight:604.65 g/molFmoc-4-Cpa-4-Cpa-OH
<p>Fmoc-4-Cpa-4-Cpa-OH is a versatile building block that can be used to synthesize complex compounds with interesting biological activity. It is a reagent, speciality chemical, and useful scaffold for research chemicals. Fmoc-4-Cpa-4-Cpa-OH has been used in the synthesis of a number of biologically active compounds and as an intermediate for the synthesis of other chemical compounds.</p>Formula:C33H28Cl2N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:603.49 g/molFmoc-Lys-OH·HCl
CAS:<p>Fmoc-Lys-OH·HCl is an acidic pyrylium that has been shown to be a potent inhibitor of tumor vasculature. It binds to the human serum albumin and inhibits the binding of ligands to the receptor tyrosine kinases, which are involved in brain tumor proliferation. Fmoc-Lys-OH·HCl has also been shown to inhibit the growth of cancer cells by binding to cell membrane receptors and inhibiting protein synthesis. This compound is also isomeric, meaning it can exist in different forms with different properties.</p>Formula:C21H24N2O4·HClPurity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:404.89 g/molα-Phellandrene
CAS:<p>Alpha-Phellandrene is a type of monoterpene that has been shown to have antioxidant properties. Alpha-Phellandrene is also known to inhibit the herpes simplex virus. In addition, alpha-Phellandrene has been shown to be a lipid and fatty acid oxidation inhibitor. Alpha-Phellandrene has been studied as an analgesic and anticonvulsant drug in animal models for pain relief and epilepsy treatment. Alpha-Phellandrene has also been studied for its ability to inhibit the production of prostaglandins by human liver cells. This terpene can be found in many plants, including thyme, lemon balm, peppermint, lavender and basil. The main chemical structure of alpha-Phellandrene is a bicyclic monoterpene with two isoprenyl units linked to a cyclohexane ring. It belongs to the group of monoterpenes which are derived from geranylgeranyl py</p>Formula:C10H16Purity:Min. 75%Color and Shape:Clear LiquidMolecular weight:136.23 g/molFITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I)
CAS:<p>Please enquire for more information about FITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H67N11O20SPurity:Min. 95%Molecular weight:1,318.32 g/mol4-Bromo-3-methoxypyridine
CAS:<p>Please enquire for more information about 4-Bromo-3-methoxypyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6BrNOPurity:Min. 95%Molecular weight:188.02 g/mol1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine
CAS:<p>1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine (DLPE) is a lipid molecule that can induce phase transition in aqueous solutions. DLPE is an active ingredient in nonsteroidal anti-inflammatory drugs and has been shown to inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase. DLPE also inhibits the growth of infectious organisms such as Escherichia coli and HIV by inhibiting receptor activity. DLPE binds to receptors on the surface of cells, which prevents these cells from releasing inflammatory cytokines.</p>Formula:C29H58NO8PPurity:Min. 95%Color and Shape:PowderMolecular weight:579.75 g/molH-Glu-Thr-Tyr-Ser-Lys-OH·2 TFA
CAS:<p>Please enquire for more information about H-Glu-Thr-Tyr-Ser-Lys-OH·2 TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H42N6O11·2C2HF3O2Purity:Min. 95%Molecular weight:854.7 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H210N40O31SPurity:Min. 95%Molecular weight:2,933.44 g/mol(D-Lys3)-GHRP-6
CAS:<p>D-Lys3-GHRP-6 is a synthetic peptide that has been shown to stimulate cellular proliferation and inhibit apoptosis in cell culture. D-Lys3-GHRP-6 binds to the ghrelin receptor, which is found on cells in the stomach and pancreas, as well as in the brain. This binding stimulates the release of cytosolic calcium and enhances protein synthesis. D-Lys3-GHRP-6 also stimulates growth factor production and increases body fat mass in animals.</p>Formula:C49H63N13O6Purity:Min. 95%Molecular weight:930.11 g/molH-Leu-Ala-Leu-Ala-OEt·HCl
CAS:<p>Please enquire for more information about H-Leu-Ala-Leu-Ala-OEt·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H38N4O5·HClPurity:Min. 95%Molecular weight:451 g/mol1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole
CAS:<p>1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole is an organic compound that is used in the synthesis of carboxylic acid derivatives. It is a synthetic intermediate, which can be converted to other compounds by intramolecular hydrogen bonding. The efficiency of this method has been shown through a number of experiments. In nature, 1-methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole may be found as a hydrogen bond donor.</p>Formula:C7H5Cl3N2O3Purity:Min. 95%Molecular weight:271.48 g/molH-Trp-Asp-OH trifluoroacetic acid
CAS:<p>H-Trp-Asp-OH trifluoroacetic acid is a protein that is localized in the kinase domain of the gene product. It has been shown to activate leishmania and human serum regulatory proteins. H-Trp-Asp-OH trifluoroacetic acid binds to guanine nucleotide binding proteins in the nuclear DNA, which may play a role in mitotic checkpoint control. This protein has also been shown to have basic properties and may be involved in plant metabolism.</p>Formula:C17H18N3O7F3Purity:Min. 95%Molecular weight:319.31 g/molAnti-Inflammatory Peptide 3
CAS:<p>Anti-Inflammatory Peptide 3 (AIP3) is a peptide that contains an ester linkages and a carboxylic ester, which are both hydrophobic. The amino acid sequence of AIP3 is H-Met-Gln-Met-Asn-Lys-Val-Leu-Asp-Ser. AIP3 has been shown to have antiinflammatory properties and can be used as a diagnostic tool for inflammation. This peptide also has prodrug properties and can be conjugated with drugs to form drug linkers.</p>Formula:C43H76N12O15S2Purity:Min. 95%Molecular weight:1,065.27 g/molRanamargarin
CAS:<p>Ranamargarin H-Asp-Asp-Ala-Ser-Asp-Arg-Ala-Lys-Lys-Phe-Tyr-Gly-Leu-Met-NH2 is a compound that has been shown to bind to the dopamine receptor in rats. It has been shown to have low potency and is not active in clinical trials. Ranamargarin H-Asp-Asp-Ala-Ser--Asp--Arg--Ala--Lys--Lys--Phe--Tyr--Gly--Leu---Met---NH2 has also been shown to inhibit the production of dopamine in animals and humans, with a maximal response at concentrations of 10 nM. The biological properties of this compound are still being researched, but it appears that it can be used as a lead for developing new drugs for treating Parkinson's disease.</p>Formula:C70H110N20O22SPurity:Min. 95%Molecular weight:1,615.81 g/mol(Des-Tyr1)-Leu-Enkephalin
CAS:<p>Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH is a synthetic opioid peptide that acts as a neuroprotective agent and has been shown to enhance the expression of nerve growth factor. It also has immunomodulatory effects by interacting with opioid receptors and regulating the production of inflammatory cytokines. Des-Tyr1-Leu-Enkephalin H-Gly-Gly-Phe-Leu-OH binds to opioid receptors in the central nervous system, thereby triggering a response that leads to pain relief and suppression of cough reflexes. This peptide has been shown to be effective in clinical trials for patients with neuropathic pain or postoperative ileus. It also shows promise as an analgesic for cancer patients with chronic pain, although this use is still experimental.</p>Formula:C19H28N4O5Purity:Min. 95%Molecular weight:392.45 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N10O7Purity:Min. 95%Molecular weight:646.74 g/molMethyl 3,5-dichloro-4-methoxybenzoate
CAS:<p>Methyl 3,5-dichloro-4-methoxybenzoate is a fine chemical and useful building block for research chemicals. It belongs to the class of speciality chemicals and can be used as a reagent in organic synthesis. Methyl 3,5-dichloro-4-methoxybenzoate is a versatile building block that has been reported in the synthesis of many complex compounds. This compound can also be used as an intermediate or scaffold for medicinal chemistry applications.</p>Formula:C9H8Cl2O3Purity:Min. 95%Molecular weight:235.06 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/molAc-Ile-Tyr(PO3H2)-Gly-Glu-Phe-NH2 ammonium salt
CAS:<p>Please enquire for more information about Ac-Ile-Tyr(PO3H2)-Gly-Glu-Phe-NH2 ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H45N6O12PPurity:Min. 95%Molecular weight:748.72 g/molPrepro-Atrial Natriuretic Factor (104-123) (human)
CAS:<p>Prepro-Atrial Natriuretic Factor (104-123) (human) H-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu -Thr-Ala Pro Arg -OH is a natriuretic peptide hormone that belongs to the family of hormones called atrial natriuretic peptides. It is produced in the heart and has been shown to lower blood pressure by dilating blood vessels. Prepronatrial atrial natriuretic factor can also be used as a marker for colorectal adenocarcinoma, with high levels found in the serum of patients suffering from this disease.</p>Formula:C94H171N31O28Purity:Min. 95%Molecular weight:2,183.56 g/molH-Cys(Fm)-OH
CAS:<p>Please enquire for more information about H-Cys(Fm)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H17NO2SPurity:Min. 95%Molecular weight:299.39 g/mol(2S)-β-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate
CAS:Controlled Product<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>Formula:C21H33N5O5Purity:Min. 95%Molecular weight:435.52 g/molH-Ala-Ala-Ala-Tyr-Ala-Ala-OH
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-Tyr-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H36N6O8Purity:Min. 95%Molecular weight:536.58 g/molPhenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about Phenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C170H280ClN53O41Purity:Min. 95%Molecular weight:3,757.83 g/molZ-Tyr-Val-Ala-DL-Asp-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Tyr-Val-Ala-DL-Asp-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37FN4O9Purity:Min. 95%Molecular weight:616.63 g/molGM-CSF (96-112)
CAS:<p>Please enquire for more information about GM-CSF (96-112) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H139N21O29SPurity:Min. 95%Molecular weight:1,987.24 g/mol(S)-(1-boc-pyrrolidin-3-yl)-acetic acid
CAS:<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molFA-Phe-Phe-OH
CAS:<p>FA-Phe-Phe-OH is a synthetic substrate for the polymerase chain reaction. It has been used in diagnostic tests to identify bacterial or viral infections and to diagnose cancer. This molecule is a mixture of three amino acids: phenylalanine, phenylalanine, and phenylalanine. FA-Phe-Phe-OH is not active against Gram-positive bacteria, but it can be used as an antibiotic against Gram-negative bacteria. The transport properties of this molecule have been shown to be radial and actin filament dependent because it binds to FtsZ proteins at the division site of the cell.</p>Formula:C25H24N2O5Purity:Min. 95%Molecular weight:432.47 g/molProlactin-Releasing Peptide (1-31) (rat)
CAS:<p>Please enquire for more information about Prolactin-Releasing Peptide (1-31) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H242N54O43SPurity:Min. 95%Molecular weight:3,593.99 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molBoc-Cys(Mob)-Merrifield resin (100-200 mesh)
<p>Please enquire for more information about Boc-Cys(Mob)-Merrifield resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molBoc-D-Tyr(tBu)-OH
CAS:<p>Boc-D-Tyr(tBu)-OH is a natural product that is an amphipathic molecule with a cyclic structure. It has been shown to be able to inhibit the growth of bacteria, such as Staphylococcus aureus and Escherichia coli, by acting as an antibiotic. Boc-D-Tyr(tBu)-OH inhibits the synthesis of peptides by binding to the ribosome and blocking peptide elongation. This molecule also inhibits peptide synthesis by interacting with the aminoacyl site on the ribosome and preventing it from binding with amino acids. Boc-D-Tyr(tBu)-OH is synthesized in two stages: solid phase peptide synthesis and nucleophilic activation. The decapeptides are then purified and characterized based on their function.</p>Formula:C18H27NO5Purity:Min. 95%Color and Shape:PowderMolecular weight:337.41 g/molAmylin (human) trifluoroacetate salt
CAS:<p>Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.</p>Formula:C165H261N51O55S2Purity:Min. 95%Molecular weight:3,903.28 g/molFmoc-Gly-Phe-OH
CAS:<p>Fmoc-Gly-Phe-OH is a photolytic residue that has been synthesized by solid-phase techniques. This molecule is an immobilized linker that can be used in photolabile devices to analyze the kinetics of biological processes. Fmoc-Gly-Phe-OH can also be used in supramolecular devices and regenerative medicine to measure the diameter of cells, as well as for regenerative purposes in humans.</p>Formula:C26H24N2O5Purity:Min. 95%Molecular weight:444.48 g/molDynorphin A (1-10) amide
CAS:<p>Dynorphin A (1-10) amide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2 is an analog of dynorphin A. It is a peptide that has been shown to be effective in reducing blood pressure and stress levels in animals. Dynorphin A (1-10) amide H-Tyr-Gly-Gly-Phe-Leu-Arg - Arg - Ile - Arg - Pro - NH2 also has analgesic properties and may be useful for the treatment of cardiac diseases.</p>Formula:C57H92N20O11Purity:Min. 95%Molecular weight:1,233.47 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS:<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formula:C70H104N22O18S·C2HF3O2Purity:Min. 95%Color and Shape:Red SolidMolecular weight:1,687.8 g/molBQ-610 Azepane-1-carbonyl-Leu-D-Trp(For)-D-Trp-OH
CAS:<p>BQ-610 is a novel peptide that has been shown to reduce the severity of mucosal inflammation in animal models of inflammatory bowel disease. It functions by binding to myofibroblasts, which are cells that produce an extracellular matrix and collagen. BQ-610 also blocks signalling pathways that are responsible for the production of TNF-α, MMP-2, and other molecules involved in the pathogenesis of inflammatory bowel disease. BQ-610 is effective at reducing inflammation in animal models of colitis, but not in human colonic epithelial cells or human colonic tissue.</p>Formula:C36H44N6O6Purity:Min. 95%Molecular weight:656.77 g/molFmoc-Lys(Boc)-Thr(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Thr(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H43N3O8Purity:Min. 95%Molecular weight:609.71 g/mol4-Bromo-2-methylbut-1-ene
CAS:<p>4-Bromo-2-methylbut-1-ene is an alkylating agent that reacts with DNA, RNA and proteins. It has been shown to be effective in the treatment of bladder cancer. 4-Bromo-2-methylbut-1-ene is used as a trifluoride source for boron trifluoride etherate, which is then reacted with plant tissues. This reaction yields a prenyl group, which can be further processed to yield an alkynyl group. The alkynyl group can be reacted with anhydrous sodium to form a chloride salt. This salt can then react with carbon monoxide to form a carbone molecule, which is the final product of this chemical process.</p>Purity:Min. 95%FA-Lys-Leu-OH
CAS:<p>Please enquire for more information about FA-Lys-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H29N3O5Purity:Min. 95%Molecular weight:379.45 g/molH-Ser-Val-OH
CAS:<p>H-Ser-Val-OH is a peptide that acts as a serotonin reuptake inhibitor. It has been shown to have antiangiogenic properties, which may be due to its ability to bind with the 5HT2A receptor and inhibit angiogenesis. H-Ser-Val-OH has also been shown to inhibit the growth of tumor cells in culture by binding to the peptide binding site on the growth factor receptor. H-Ser-Val-OH can be used for cancer therapy by increasing radiation sensitivity and inhibiting tumor perfusion.</p>Formula:C8H16N2O4Purity:Min. 95%Molecular weight:204.22 g/molH-Pro-Phe-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O4Purity:Min. 95%Molecular weight:390.48 g/molAc-Ile-Glu-Thr-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is a neurotrophic factor that plays an important role in the development and function of the nervous system. It stimulates the production of other neurotrophic factors such as NGF, BDNF, and GDNF. This protein has been shown to be involved in a number of autoimmune diseases, including multiple sclerosis and rheumatoid arthritis. Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is also known to reduce neuronal death by binding to toll receptors on neurons and activating mitogen activated protein kinases. Acetylcholine esterase activity can also be inhibited by this protein. Acetylcholine esterase is responsible for breaking down acetylcholine, which is a neurotransmitter that transmits nerve impulses across the synapses between neurons. The inhibition of this enzyme leads to an increase in acetylcholine levels and increased transmission of</p>Formula:C21H34N4O10Purity:Min. 95%Molecular weight:502.52 g/molHomo-L-tyrosine hydrobromide
CAS:<p>Homo-L-tyrosine hydrobromide (HLTB) is a prodrug that is converted to L-3,4-dihydroxyphenylalanine (L-dopa) in vivo. It is used as an immunomodulator by stimulating the immune system and reducing inflammation. HLTB has been shown to have anti-inflammatory effects on the production of cytokines and chemokines, which are important for tumor growth and metastasis. HLTB is also known to inhibit tyrosine kinase, which plays a role in the development of some cancers.</p>Formula:C10H14BrNO3Purity:Min. 95%Molecular weight:276.13 g/molAtriopeptin III (rat)
CAS:<p>Atriopeptin III is a peptide hormone that belongs to the atrial natriuretic peptide group. It is an analog of atrial natriuretic peptide (ANP), which regulates blood pressure and sodium excretion, and has minimal toxicity. The disulfide bond between Cys-Cys and Cys-Gly on the N terminus of Atriopeptin III is necessary for its activity. The enzyme responsible for this disulfide bond formation is thioredoxin reductase, which is found in the cytoplasm of cells. Atriopeptin III has been shown to inhibit cyclase activity in renal proximal tubular cells, as well as congestive heart failure in rats. It also inhibits fatty acid synthesis by inhibiting carnitine acyltransferase I, leading to increased levels of free fatty acids and diacylglycerols in the blood plasma.</p>Formula:C107H165N35O34S2Purity:Min. 95%Molecular weight:2,549.8 g/molH-Lys(Boc)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Osteostatin amide trifluoroacetate
CAS:<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O57•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,450.59 g/molAcetyl-Amylin (8-37) (mouse, rat)
CAS:<p>Please enquire for more information about Acetyl-Amylin (8-37) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H229N43O44Purity:Min. 95%Molecular weight:3,242.6 g/molH-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn-OH
CAS:<p>H-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn is a cytosolic protein that is an inhibitor of protein synthesis. It has been shown to inhibit the activity of proteases, such as caspase 1, and to activate caspase 1. This inhibition is consequent to the inhibition of polypeptide chain elongation and may be due to the ability of HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH to bind to peptidyl transferase or other proteins involved in protein synthesis. HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH binds to primary keratinocytes and k562 cells more efficiently than it does to thp1 cells, suggesting that it may have a role in skin cancer.</p>Formula:C68H105N21O23Purity:Min. 95%Molecular weight:1,584.69 g/molN-Boc-cis-3,4-methylene D-proline
CAS:<p>Please enquire for more information about N-Boc-cis-3,4-methylene D-proline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17NO4Purity:Min. 95%Molecular weight:227.26 g/molSuc-Val-Pro-Phe-4MbNA
CAS:<p>Please enquire for more information about Suc-Val-Pro-Phe-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H40N4O7Purity:Min. 95%Molecular weight:616.7 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol3-Methyldihydrofuran-2,5-dione
CAS:<p>3-Methyldihydrofuran-2,5-dione is a diterpenoid alkaloid found in the plant Dictamnus albus. This compound has been shown to have metal chelating properties and can be used as an asymmetric synthesis intermediate. 3-Methyldihydrofuran-2,5-dione reacts with diazonium salt to form a high resistance molecule that is highly reactive. This chemical reacts with hydroxyl groups, amide groups, or methyl ethyl groups. The structure of this compound consists of nitrogen atoms and anhydride bonds. 3-Methyldihydrofuran-2,5-dione has been shown to exhibit electrochemical impedance spectroscopy (EIS) characteristics similar to those of other molecules that are known to be reactive.</p>Formula:C5H6O3Purity:Min. 95%Molecular weight:114.1 g/molZ-Phe-His-Leu-OH
CAS:<p>Z-Phe-His-Leu-OH is a monoclonal antibody that is used in the diagnosis and treatment of prostate cancer. This drug binds to the extracellular domain of the human prostate epithelial cell antigen (PSA), which is overexpressed in prostate cancers. Z-Phe-His-Leu-OH can be used in combination with other drugs for the treatment of prostate hyperplasia, such as angiotensin II receptor antagonists or 5α reductase inhibitors. The conformational epitope of this antibody has been demonstrated by immunohistochemical analysis on human tissues.</p>Formula:C29H35N5O6Purity:Min. 95%Molecular weight:549.62 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H160N34O27Purity:Min. 95%Molecular weight:2,210.5 g/molAc-Leu-Glu-Val-Asp-AFC
CAS:<p>Please enquire for more information about Ac-Leu-Glu-Val-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H40F3N5O11Purity:Min. 95%Molecular weight:727.68 g/molH-β-Cyclohexyl-Ala-OMe·HCl
CAS:<p>Please enquire for more information about H-beta-Cyclohexyl-Ala-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO2·HClPurity:Min. 95%Molecular weight:221.72 g/molNeuronostatin-19 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H153N29O26Purity:Min. 95%Molecular weight:2,069.37 g/molH-Ala-His-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/molAc-Tyr-Phe-OMe
CAS:<p>Please enquire for more information about Ac-Tyr-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molH-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH
CAS:<p>Please enquire for more information about H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H122N24O19Purity:Min. 95%Molecular weight:1,760.01 g/molTIPP
CAS:<p>TIPP is a peptide that belongs to the group of chemokines. It has been shown to have receptor binding activity and to stimulate the release of pro-inflammatory cytokines in cancer cells. TIPP interacts with membranes by forming hydrogen bonds with carbonyl groups and hydroxyl groups, which are located in the membrane. This results in a low energy barrier for intramolecular hydrogen transfer, making it a suitable candidate for drug design. TIPP also interacts with receptors, such as δ receptors, which may contribute to its anti-cancer properties.</p>Formula:C37H38N4O6Purity:Min. 95%Molecular weight:634.72 g/molFibronectin Receptor Peptide (124-131)
CAS:<p>Please enquire for more information about Fibronectin Receptor Peptide (124-131) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H72N8O15SPurity:Min. 95%Molecular weight:1,045.21 g/molFmoc-Ile-OH
CAS:<p>Fmoc-Ile-OH is a cyclic peptide that has shown cytotoxic activity against cultured human brain cells. It is also an inhibitor of dipeptidyl peptidase IV (DPP-IV) and inhibits the breakdown of proteins in the brain, such as insulin. Fmoc-Ile-OH binds to the active site of DPP-IV and prevents it from binding to its substrate, thereby inhibiting the enzyme's activity. The inhibition of DPP-IV leads to increased levels of protein in the brain, which may be beneficial for people with Alzheimer's disease. Fmoc-Ile-OH is synthesized on a solid phase by coupling an amino acid with a protected carboxylic acid to yield a protected amide. This product can be used as an encapsulating agent for atosiban, a drug that is used to treat preterm labor.END>></p>Formula:C21H23NO4Purity:Min. 98 Area-%Color and Shape:White Off-White PowderMolecular weight:353.41 g/molH-β,β-Dicyclohexyl-DL-Ala-OH
CAS:<p>Please enquire for more information about H-beta,beta-Dicyclohexyl-DL-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H27NO2Purity:Min. 95%Molecular weight:253.38 g/molZ-Leu-Phe-NH2
CAS:<p>Please enquire for more information about Z-Leu-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H29N3O4Purity:Min. 95%Molecular weight:411.49 g/molTRAP-5 trifluoroacetate salt
CAS:<p>TRAP-5 is a peptide consisting of the amino acid sequence H-Ser-Phe-Leu-Leu-Arg. This peptide has been shown to have antiviral, anti-inflammatory, and anticancer properties. It has also been found to inhibit platelet activation in vitro and to reduce atherosclerotic lesions in mice. TRAP-5 has been shown to have therapeutic potential for diseases such as heart disease and lung diseases, although its efficacy has not yet been tested in humans.</p>Formula:C30H50N8O7Purity:Min. 95%Molecular weight:634.77 g/molCyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.</p>Formula:C28H43N9O7Purity:Min. 95%Molecular weight:617.7 g/molFmoc-Thr(tBu)-Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Thr(tBu)-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H30N2O6Purity:Min. 95%Molecular weight:454.52 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H73N13O26Purity:Min. 95%Molecular weight:1,344.25 g/molACTH (1-39) (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C210H315N57O57SPurity:Min. 95%Molecular weight:4,582.16 g/molH-His-Phe-bNA·2 HCl
CAS:<p>Please enquire for more information about H-His-Phe-bNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H25N5O2·2HClPurity:Min. 95%Molecular weight:500.42 g/molCyclo(-D-Glu-Ala-D-allo-Ile-Leu-D-Trp)
CAS:<p>Please enquire for more information about Cyclo(-D-Glu-Ala-D-allo-Ile-Leu-D-Trp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H44N6O7Purity:Min. 95%Molecular weight:612.72 g/molType A Allatostatin II
CAS:<p>Allatostatin II is a fatty acid that has been shown to have receptor activity. It is an analog of the glycopeptide antibiotic gramicidin S and has been shown to inhibit the growth of bacteria and fungi. Allatostatin II also has diagnostic properties, which are used in biochemical tests for inflammatory diseases. The molecule is conjugated with various agents to form diagnostic agents or antibiotics, such as stenotrophomonas maltophilia and erythromycin. Allatostatin II is found in the human plasma, but its function is unknown.</p>Formula:C49H74N14O13Purity:Min. 95%Molecular weight:1,067.2 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/mol(4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid
CAS:<p>Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H11BO4Purity:Min. 95%Molecular weight:193.99 g/molH-Phe-Pro-Arg-OH
CAS:<p>H-Phe-Pro-Arg-OH is an active analogue of the natural amino acid, lysine. It has been shown to inhibit protein synthesis by binding to the lysine residues in proteins. This inhibition blocks the hydrophobic effect that is necessary for proper folding of newly synthesized proteins. Lysine's role in protein synthesis also extends to spermatozoa and blood clotting, which are inhibited by H-Phe-Pro-Arg-OH. The inhibition of lysine residues in human serum fibrinogen and thrombin may lead to a reduction in their ability to form clots. H-Phe-Pro-Arg-OH has also been shown to be an anticoagulant and thermodynamic data supports this conclusion. X ray crystal structures and titration calorimetry have confirmed that this compound binds to lysine residues with high affinity and specificity.</p>Formula:C20H30N6O4Purity:Min. 95%Molecular weight:418.49 g/mol1-O-Octadecyl-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-Octadecyl-2-O-acetyl-sn-glycero-3-phosphocholine (OGPC) is a phospholipid that has been shown to be an effective drug in the treatment of chronic arthritis. It is a potent antagonist of the inflammatory response, and has been shown to inhibit the production of inflammatory cytokines such as tumour necrosis factor alpha (TNFα). OGPC has been used in cell culture studies, which have shown that it inhibits IL2 receptor binding and TNFα release by human monocytes. Clinical studies have also shown that OGPC can be used to treat arthritis.</p>Formula:C28H58NO7PPurity:Min. 95%Molecular weight:551.74 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/molFmoc-Dap(Adpoc)-OH
CAS:<p>Please enquire for more information about Fmoc-Dap(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N2O6Purity:Min. 95%Molecular weight:546.65 g/molCholecystokinin Octapeptide (1-3) (desulfated)
CAS:<p>Cholecystokinin Octapeptide (1-3) (desulfated) is a research chemical that has various applications in the field of chemistry and biology. This compound contains a hydrogen atom that plays a crucial role in solvation processes. It can be used in supercritical reactions due to its ability to interact with hydroxyl groups on metallic surfaces like silicon substrates. Additionally, Cholecystokinin Octapeptide (1-3) (desulfated) is utilized in thiol-ene reactions and chromatographic separations.</p>Formula:C18H25N3O7SPurity:Min. 95%Molecular weight:427.47 g/molZ-Val-Ala-OMe
CAS:<p>Z-Val-Ala-OMe is an anti-leishmanial agent that has been shown to be a more efficient method for the treatment of leishmaniasis than current treatments. It inhibits the growth of Leishmania by inhibiting serine proteases, which are involved in the formation of amorphous material on the surface of these parasites. Z-Val-Ala-OMe is active against both subtilis and licheniformis, with a residue half life of 3 hours at pH 5.5 and 20 degrees Celsius. This drug binds to the surface of Leishmania parasites and inhibits their ability to metabolize phosphite into ethyl esters.<br>The kinetic data obtained from Z-Val-Ala-OMe was measured using immobilized cells in a microtiter plate assay system. The data collected was used to generate a graph showing an initial burst phase followed by a linear phase for up to 72 hours post incubation with the drug</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol4-Bromo-2-methylthiophene
CAS:<p>4-Bromo-2-methylthiophene is a linker that is used in the synthesis of metal carbonyls. It has been shown to be an efficient cross-linking agent for the preparation of polymers. 4-Bromo-2-methylthiophene can be isomerized to 2,5-dimethylthiophene by heating it with hydroxylamine. 4-Bromo-2-methylthiophene can also catalyze the alkylation of nucleophiles such as ammonia and dimethyl sulfate, as well as nucleophilic attack on carboxylic acid derivatives. This compound is acidic, due to its chloride substituent, which can react with basic groups such as hydroxyl groups or amines.</p>Formula:C5H5BrSPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:177.06 g/molH-Gly-D-Val-OH
CAS:<p>H-Gly-D-Val-OH is a nonpolar amino acid that belongs to the group of amino acids. It is one of the 20 standard amino acids used by living cells and is found in proteins. The nitrogen atoms are located at the corners of a rectangle and are involved in hydrogen bonding. H-Gly-D-Val-OH is a component of fatty acids, which are molecules that form an important part of the human diet. Fatty acids are taken up by cells through endocytosis and metabolized within the cell cytoplasm by catabolism or anabolism. H-Gly-D-Val-OH has been shown to have kinetic properties in vitro and can be used as a ternary complex forming agent with glycine and D,L-valine when mixed with water. H Gly D Val OH also acts as a cyclic peptide, which can be synthesized from H Gly D Val OH with the help of</p>Formula:C7H14N2O3Purity:Min. 95%Molecular weight:174.2 g/molAloc-OSu
CAS:<p>Aloc-OSu is a glycosylated glycopeptide antibiotic that belongs to the class of degradable antibiotics. The drug binds to the enzyme UDP-N-acetylglucosamine:glycoprotein glucosyltransferase, thereby inhibiting bacterial cell wall synthesis. Aloc-OSu has been shown to be effective against methicillin resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. Aloc-OSu has shown anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis.</p>Formula:C8H9NO5Purity:Min. 95%Molecular weight:199.16 g/mol(H-Cys-allyl ester)2·2 p-tosylate (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-allyl ester)2·2 p-tosylate (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N2O4S2·2C7H8O3SPurity:Min. 95%Molecular weight:664.84 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molHIV Protease Substrate VII
CAS:<p>Please enquire for more information about HIV Protease Substrate VII including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H81N15O14Purity:Min. 95%Molecular weight:1,140.29 g/molH-Ala-Phe-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Phe-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H20N4O4·HClPurity:Min. 95%Molecular weight:392.84 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Val-Phe-OH
CAS:<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>Formula:C14H20N2O3Purity:Min. 95%Molecular weight:264.32 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H113N21O25Purity:Min. 95%Molecular weight:1,888.99 g/mol(D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H290N56O56Purity:Min. 95%Molecular weight:4,338.75 g/molBPP 9a Pyr-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro-OH
CAS:<p>BPP 9a is an enzyme inhibitor that binds to the active site of angiotensin-converting enzyme (ACE) and blocks its activity. It is a nonsteroidal anti-inflammatory drug that has been shown to be effective in reducing inflammation and pain associated with arthritis, osteoarthritis, gout, and menstrual cramps. BPP 9a has also been shown to reduce blood pressure in a dose-dependent manner, which may be due to its ability to inhibit the synthesis of angiotensin II from angiotensin I. This inhibition may lead to decreased vascular tone and blood pressure. BPP 9a has also been shown to have beneficial effects on bowel disease and polymerase chain reaction (PCR) analysis of DNA.</p>Formula:C53H76N14O12Purity:Min. 95%Molecular weight:1,101.26 g/mol1,2-Dilauroyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>Formula:C32H64NO8PPurity:Min. 95%Molecular weight:621.83 g/molH-Gly-Arg-Gly-Glu-Thr-Pro-OH
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Thr-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H41N9O10Purity:Min. 95%Molecular weight:615.64 g/molBoc-L-tyrosine methyl ester
CAS:<p>Boc-L-tyrosine methyl ester is a synthetic amino acid that can be used in the production of peptides and proteins. It has been shown to have a high uptake and hydroxyl group, which allows for the synthesis of dopamine. The kinetic study of Boc-L-tyrosine methyl ester in agarose gels has shown that it has a high affinity for dopamine. Boc-L-tyrosine methyl ester has also been used as an intermediate for the synthesis of peptides and proteins. It is not active against cancer cells but has been used to induce matrix metalloproteinase (MMP) activity in Mcf-7 cells.</p>Formula:C15H21NO5Purity:Min. 95%Color and Shape:White PowderMolecular weight:295.33 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molSubstance P (5-11) trifluoroacetate salt
CAS:<p>Substance P is a bifunctional neuropeptide that acts as both a neurotransmitter and a neurohormone. The amino acid sequence of Substance P is H-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2. It is found in the brain and spinal cord, but also in other tissues such as the parotid gland and stomach. This peptide is released from nerve cells when they are stimulated by pain or anxiety, and it causes contraction of smooth muscles in the lungs, uterus, and gastrointestinal tract. Animal studies have shown that Substance P can be toxic to neonatal animals, leading to hypothyroidism and death. In vitro studies have shown that this peptide can induce the growth of glioma cells and tumors.</p>Formula:C41H60N10O9SPurity:Min. 95%Molecular weight:869.04 g/molH-D-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-D-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molBoc-L-β-homoleucine
CAS:<p>Please enquire for more information about Boc-L-beta-homoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23NO4Purity:Min. 95%Molecular weight:245.32 g/molFmoc-Lys(Boc)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molZ-Ala-Ser-OH
CAS:<p>Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.</p>Formula:C14H18N2O6Purity:Min. 95%Color and Shape:PowderMolecular weight:310.3 g/molZ-Arg-Arg-bNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H39N9O4Purity:Min. 95%Molecular weight:589.69 g/molMethyl 3-amino-2-phenylpropanoate HCl
CAS:<p>Methyl 3-amino-2-phenylpropanoate HCl is a chemical intermediate that is synthesized in the biosynthesis of scopolamine and tenellin. It has been found to be an isotopically labeled analog of tropane alkaloids, which are a class of natural products that includes atropine, hyoscyamine, and scopolamine. Methyl 3-amino-2-phenylpropanoate HCl is one of many compounds that can provide structural insights into the biosynthesis and metabolism of these compounds.</p>Formula:C10H13NO2·HClPurity:Area-% Min. 95 Area-%Color and Shape:PowderMolecular weight:215.68 g/molZ-His-p-nitro-Phe-Phe-OMe
CAS:<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H34N6O8Purity:Min. 95%Molecular weight:642.66 g/molZ-Gly-Pro-pNA
CAS:<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>Formula:C21H22N4O6Purity:Min. 95%Molecular weight:426.42 g/molCharacteristic MSH-Tetrapeptide
CAS:<p>The melanocortin-4 receptor (MC4R) is a G protein-coupled receptor that mediates the protective and cytoprotective activities of endogenous melanocortins. This receptor has been shown to be an important target for neuroprotective agents. The MC4R is expressed in the central nervous system, peripheral nervous system, and other tissues where it may have a role in regulating energy homeostasis. The N-terminal amino acid sequence of the human MC4R ligand is H-His-Phe-Arg-Trp-OH. This peptide has been shown to have potent agonist potency at the MC4R with a Kd of 0.2 nM and an EC50 of 2 nM.</p>Formula:C32H40N10O5Purity:Min. 95%Molecular weight:644.72 g/molH-β-Chloro-Ala-NHOH hydrochloride salt
CAS:<p>Please enquire for more information about H-beta-Chloro-Ala-NHOH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C3H7ClN2O2Purity:Min. 95%Molecular weight:138.55 g/mol(Arg8)-Conopressin G trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H71N17O10S2Purity:Min. 95%Molecular weight:1,062.28 g/mol6-Bromo-1-methylindazole
CAS:<p>6-Bromo-1-methylindazole is an industrial chemical that can be synthesized by the reaction of formate, methanol, and indazole. The synthesis method involves the esterification of methyl formate with indazole to produce 6-bromo-1-methylindazole. It can also be synthesized by the annulation of methyl formate and cyclopentadiene followed by hydrolysis. This chemical has several isomers that are distinguished from each other based on their synthesis methods. 6-Bromo-1-methylindazole has been shown to have a hydrolysis reaction when it reacts with water, producing methyl bromide and hydrogen bromide.</p>Formula:C8H7BrN2Purity:Min. 95%Molecular weight:211.06 g/molH-Val-4MbNA·HCl
CAS:<p>Please enquire for more information about H-Val-4MbNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N2O2·HClPurity:Min. 95%Molecular weight:308.8 g/molAc-Ala-Ala-Pro-Phe-pNA
CAS:<p>Ac-Ala-Ala-Pro-Phe-pNA is a serine protease inhibitor that has been shown to inhibit chymotrypsin, elastase, and other serine proteases. It is benzoylated to protect it from proteolytic degradation in the gastrointestinal tract and can be used as a therapeutic treatment for inflammatory bowel disease, pancreatitis, or other chronic diseases. Ac-Ala-Ala-Pro-Phe-pNA can be inactivated by thermal treatment (e.g., boiling) or by chemical reduction (e.g., sodium borohydride).</p>Formula:C28H34N6O7Purity:Min. 95%Molecular weight:566.61 g/molCRAMP (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/molH-Lys-Leu-OH acetate salt
CAS:<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>Formula:C12H25N3O3·C2H4O2Purity:Min. 95%Molecular weight:319.4 g/molH-Phe-Phe-Phe-Phe-OH
CAS:<p>Please enquire for more information about H-Phe-Phe-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H38N4O5Purity:Min. 95%Molecular weight:606.71 g/molH-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H285N55O57SPurity:Min. 95%Molecular weight:4,271.69 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H47FN4O15Purity:Min. 95%Molecular weight:878.85 g/mol1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt)
CAS:<p>1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:(C2H4O)nC44H87N2O10P•H3NPurity:Min. 95%Color and Shape:White Powder(D-Cys(tBu)2,Thr(tBu)6)-Leu-Enkephalin-Thr
CAS:<p>Leu-Enkephalin is a synthetic opioid peptide that exhibits potent analgesic effects and is used in the treatment of a variety of pain syndromes. Leu-Enkephalin has been shown to have an inhibitory effect on δ-opioid receptors, which are involved in the transmission of pain signals. Leu-Enkephalin has also been shown to have an inhibitory effect on other enzymes such as aminopeptidases, proteases, and kinases. This drug has been used in the treatment of autoimmune diseases, cancer, and inflammatory diseases. Leu-Enkephalin is also known to increase locomotor activity and reduce sensitivity to pain.</p>Formula:C41H62N6O9SPurity:Min. 95%Molecular weight:815.03 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/molZ-Gly-Gly-Gly-OSu
CAS:<p>Please enquire for more information about Z-Gly-Gly-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H20N4O8Purity:Min. 95%Molecular weight:420.37 g/mol3-Fluoro-4-methoxybenzoic acid
CAS:<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molPyr-Trp-Gly-NH2
CAS:<p>Please enquire for more information about Pyr-Trp-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H21N5O4Purity:Min. 95%Molecular weight:371.39 g/molCyclo(-D-Ala-Val)
CAS:<p>Please enquire for more information about Cyclo(-D-Ala-Val) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O2Purity:Min. 95%Molecular weight:170.21 g/mol
