Amino Acids (AA)

<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>

<p>Please enquire for more information about (Nle 10)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cholecystokinin Octapeptide (1-3) (desulfated) is a research chemical that has various applications in the field of chemistry and biology. This compound contains a hydrogen atom that plays a crucial role in solvation processes. It can be used in supercritical reactions due to its ability to interact with hydroxyl groups on metallic surfaces like silicon substrates. Additionally, Cholecystokinin Octapeptide (1-3) (desulfated) is utilized in thiol-ene reactions and chromatographic separations.</p>

<p>Please enquire for more information about GM-CSF (17-31) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Ala-OMe is a serine protease inhibitor that binds to serine proteases, including chymotrypsin, trypsin, and elastase. The inhibition of these enzymes prevents the hydrolysis of proteins by these enzymes, which can lead to cell death. Z-Ala-Ala-OMe has been shown to inhibit the growth of bacteria in vitro and in animal models. This compound also showed an ability to inhibit the production of phosphite by immobilized subtilisin from Bacillus licheniformis (Bacillus subtilis) with a Km value of 0.5 mM</p>

<p>Dynorphin B is a peptide hormone that is found in the brain and spinal cord. It is one of the many endogenous opioid peptides that bind to kappa-opioid receptors. Dynorphin B has been shown to have pain-relieving effects, which are mediated by its ability to inhibit neuronal activity in the nociceptive pathway. Dynorphin B has also been shown to have significant anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis. Dynorphin B can also reduce locomotor activity and increase dopamine release, which may be due to its ability to activate dopamine receptors.</p>

<p>Boc-Tyr(tBu)-OH is a chemical compound that is part of the class of lactams. It has been shown to have antitumor activity in vitro and in vivo, but it has not yet been tested for its cytotoxicity. This compound is synthesized by solid-phase synthesis and contains a disulfide bond, which may contribute to its cytotoxicity. Boc-Tyr(tBu)-OH has also been shown to have high affinity for the alpha 2A adrenergic receptor subtype and other receptors with an isosteric carbonyl group.</p>

<p>H-D-Lys(Z)-OMe·HCl is a chemical compound that belongs to the group of organic nitrogen. It has been used in an experiment that monitored the population of a specific ecosystem. The experiment focused on the effects of organic nitrogen on the organisms living in this ecosystem. H-D-Lys(Z)-OMe·HCl was also used as a permission for an ecological research project, which focused on the behavioural patterns of animals in a natural environment. This compound has also been sponsored by science organisations, such as Ecological Society of America and Society for Experimental Biology.</p>

<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>

<p>Please enquire for more information about Z-Arg-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hippuryl-Lys-OH is a novel, potent and selective serine protease inhibitor that targets human cathepsin B. It has been shown to have inhibitory properties against other serine proteases such as chymotrypsin, trypsin, and elastase. Hippuryl-Lys-OH is used in the treatment of cancer patients with diabetes who require a creatine level less than 400 μM per liter of serum. It also has potential applications in the treatment of Alzheimer's disease and Parkinson's disease due to its ability to inhibit polymerase chain reactions (PCR).</p>

<p>Please enquire for more information about H-Ala-Gly-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetylation is the process of reacting an organic compound with acetic acid to produce an ester and water. Acetylation is one of the most common reactions in organic chemistry. Acetylating agents, such as acetic anhydride or acetyl chloride, are often used in chemical synthesis because they react selectively with primary and secondary alcohols to form esters. The acetylation reaction can be used to modify proteins by attaching an acetyl group to the amine group of a lysine residue. This modification prevents the protein from binding to other proteins and can alter its function. Acetylation also has been implicated in several diseases, such as hepatitis and inflammatory bowel disease.</p>

<p>Substance P (4-11) H-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a fluorescent peptide that binds to calcium and chloride ions. It has been shown to have an affinity for both peptide and calmodulin binding. This peptide has also been shown to be highly heat stable and can be used in a wide range of temperatures. The substance P (4-11) sequence is found in porcine, rat, bovine, and human proteins. The amino acid sequence is composed of 4 amino acids: proline, glutamine, phenylalanine, and leucine. This peptide's optimum pH is 7.5 with a temperature range of 35°C to 45°C. It has been shown that the activity of this peptide decreases as the concentration increases. It has also been shown to be susceptible to aminopeptidases at high concentrations or when</p>

<p>Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Glu-OH is a small molecule that is used as a pharmacological agent for the treatment of diabetes. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of inflammatory mediators such as prostaglandin E2 and nitric oxide. H-Arg-Glu-OH also induces apoptosis in human monocytes and macrophages by binding to toll-like receptor 4 (TLR4) on the cell surface. This binding activates NFκB and JNK pathways, leading to the induction of apoptosis. H-Arg-Glu-OH binds with high affinity to monoclonal antibodies against glutamic acid and glycine, which are not present in humans. The compound may be toxic at a neutral pH because it is highly reactive due to intramolecular hydrogen bonding between carbonyl oxygens and amide hydrogens.</p>

<p>Please enquire for more information about Fmoc-4,5-dehydro-L-leucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt is a synthetic, ternary complex of the amino acid histidine, arginine and lysine. It has been shown to inhibit β lactamase enzymes that are responsible for the hydrolysis of penicillin, cephalosporin, and monobactam antibiotics. The inhibition is due to the hydrophobic nature of the substrate binding site on β lactamase. This binding prevents the enzyme from hydrolyzing its substrate and inactivates it. In addition, H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt binds to calcium ions and has been shown to have a kinetic effect on β lactamases.</p>

<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>

<p>Please enquire for more information about MeOSuc-Val-Val-Ile-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (TRITC)7)-Phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Gln-NH2 is a multifunctional protein that has been covalently immobilized on the surface of a glass fiber. It can be used to immobilize enzymes and other proteins, as well as being able to function as an enzyme itself. Ac-Gln-NH2 has been shown to conjugate with various molecules, including antibodies, DNA, and proteins. The immobilizing process involves cross-linking the protein to the glass surface through a chemical method that uses reagents such as glutaraldehyde or epoxy resin. Immobilization of Ac-Gln-NH2 onto a glass surface allows for easier use in applications such as diagnostics and industrial processes.</p>

<p>Please enquire for more information about H-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-cys(Npys)-oh is an active substance that inhibits the growth of mouse tumors and has been shown to inhibit a number of different biological processes. It is a cross-linking agent for amino acids and has been shown to have an inhibitory effect on the synthesis of proteins by blocking the formation of disulfide bonds. This compound belongs to the class of chemicals known as sulfonamides, which are used in the treatment of bacterial infections. Boc-cys(Npys)-oh also specifically binds to antigen sites on cells, inhibiting their growth, and can be used as an antitumor agent. The molecule can be chemically linked with other molecules such as trifluoroacetic acid (TFA), resulting in a product with different properties than those found in Boc-cys(Npys)-oh. The chemical ligation process is used to produce subcutaneous tumors in mice that are then treated with hydrogen fluoride (</p>

<p>H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH is a diacylglycerol that regulates the expression of genes and has been shown to modulate hematopoietic cells. This compound is a derivative of atypical proteins, which are proteins that have an atypical tertiary structure and do not possess a classical signal peptide or secretion signal. H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg -OH has been shown to be expressed in hematopoietic growth regulator domains, which may account for its pleiotropic effects on hematopoietic cells.</p>

<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Dap(Ac)-OH is a fine chemical that is used as a building block in the synthesis of complex compounds. It reacts with various nucleophiles to form an amide bond, and has been shown to be useful for both research and industrial applications. Fmoc-Dap(Ac)-OH can also be used as a reagent to synthesize peptides, which are biologically active compounds that form the basis of many drugs. This versatile intermediate is also used as a scaffold in the construction of more complex molecules. Fmoc-Dap(Ac)-OH has CAS No. 181952-29-4 and is classified as a speciality chemical by the International Union of Pure and Applied Chemistry (IUPAC).</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-His-Leu-Thr-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>

<p>Please enquire for more information about Calcium-Like Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Et-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Bromo-2-methylthiophene is a linker that is used in the synthesis of metal carbonyls. It has been shown to be an efficient cross-linking agent for the preparation of polymers. 4-Bromo-2-methylthiophene can be isomerized to 2,5-dimethylthiophene by heating it with hydroxylamine. 4-Bromo-2-methylthiophene can also catalyze the alkylation of nucleophiles such as ammonia and dimethyl sulfate, as well as nucleophilic attack on carboxylic acid derivatives. This compound is acidic, due to its chloride substituent, which can react with basic groups such as hydroxyl groups or amines.</p>

<p>Please enquire for more information about Z-Val-D-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-N-Me-Tyr-Val-Ala-Asp-aldehyde (pseudo acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>

<p>Please enquire for more information about (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Ser-Phe-OH is a synthetic molecule that is a serine protease. It has been shown to have phosphatase activity, which can be used in the processing of milk proteins. This enzyme can also be used in the production of acid casein and colostrum. The enzyme has been shown to convert aspartic acid into asparagine, which is then converted into aminosugars such as melamine and phenylalanine. H-Leu-Ser-Phe-OH can be used for the treatment of fibrinogen deficiency, with its ability to cleave fibrinogen at the γ site. The enzyme has also been shown to have an effect on blood coagulation by cleaving fibrinogens at the γ site, thus preventing clot formation.</p>

<p>Please enquire for more information about Z-Leu-Leu-Tyr-a-keto aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Moth Cytochrome C (MCC) Fragment including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>

<p>Please enquire for more information about (Lys9,Trp11,Glu12)-Neurotensin (8-13) (Cyclic Analog) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Atriopeptin III is a peptide hormone that belongs to the atrial natriuretic peptide group. It is an analog of atrial natriuretic peptide (ANP), which regulates blood pressure and sodium excretion, and has minimal toxicity. The disulfide bond between Cys-Cys and Cys-Gly on the N terminus of Atriopeptin III is necessary for its activity. The enzyme responsible for this disulfide bond formation is thioredoxin reductase, which is found in the cytoplasm of cells. Atriopeptin III has been shown to inhibit cyclase activity in renal proximal tubular cells, as well as congestive heart failure in rats. It also inhibits fatty acid synthesis by inhibiting carnitine acyltransferase I, leading to increased levels of free fatty acids and diacylglycerols in the blood plasma.</p>

<p>Substance P is a neuropeptide that is found in the central nervous system. It is also found in the gastrointestinal tract and plays a role in the regulation of smooth muscle contraction. Substance P has been shown to be involved in inflammatory responses, immune responses, and regulation of water and electrolyte balance. The maximal response of substance P occurs at concentrations between 0.1 to 1 nM and its inhibitory effect on the apical Ca2+ response occurs at concentrations between 10-100 nM. In addition, substance P has been shown to have an excitatory effect on 5-HT7 receptors with subunit composition GluN1/GluN2A/GluN2B/GluN3A/5-HT7(H).</p>

<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Gly-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Trp-OH is a peptide that is synthesized by combining the amino acids glycine, alanine, and tryptophan. It is used in a variety of applications, including as an antimicrobial agent, sweetener, and health care product. Z-Gly-Trp-OH has been shown to have potential health benefits such as improved insulin sensitivity and prevention of cardiovascular disease. The strategies for synthesizing this peptide are dependent on the availability of different amino acid building blocks. For example, zinc ions may be used to catalyze the condensation of glycine with tryptophan.</p>

<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 is a synthetic peptide that was designed to mimic the sequence of muramyl dipeptide (MDP), which is found in bacterial cell walls. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 binds to the protein albumin, which is an important component of human blood plasma and has been shown to be elevated in patients with autoimmune diseases. This peptide also inhibits the activity of metal hydroxides, such as aluminum hydroxide and calcium hydroxide, by binding to their surface, reducing their antimicrobial activity. The effect on locomotor activity has not been studied. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 may have effects on various cells types including macrophages and T</p>

<p>Met-enkephalin is a molecule that is formed from two of the three parts of the endorphin molecule, which are Tyr-Gly-Gly-Phe and Met(O)OH. It is a neurotransmitter that has been shown to inhibit pain in humans and animals. In coelomocytes, met-enkephalin binds to receptors on the cell membrane and inhibits the release of dopamine by binding to dopamine receptors. The sulfoxide group of this molecule can be reduced to form enkephalinase, which is an enzyme that cleaves Met(O)OH from the peptide chain. This process is not known to occur in humans or other mammals. Met-enkephalin has been localized in ganglia cells in animals, but not humans. It has also been found in messenger RNA (mRNA) for translation into protein, but it does not appear to be translated into protein in humans or other mammals.</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg(Pbf)-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Asn-NH2 sulfate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endotoxin inhibitor H-Lys-Thr-Lys-Cys-Lys-Phe-Leu-Lys-Lys-Cys-OH is a natural disulfide bond that inhibits cytosolic Ca2+ release and bacterial translocation. It has been shown to decrease the production of tumor necrosis factor alpha (TNFα) in vitro, which may be due to its effects on protein synthesis. It also has antimicrobial activity against bacteria such as Clostridium perfringens, Mycobacterium tuberculosis, and Mycobacterium avium complex. Endotoxin inhibitor H-Lys-Thr-Lys-Cys-Lys-Phe-Leu-Lys-- Lys -Cys -OH binds to the ribosomal RNA of bacteria, inhibiting protein synthesis by binding to the peptidyl transferase center</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Z-Lys(Z)-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hippuryl-His-Leu-OH is a peptide that inhibits the activity of angiotensin converting enzyme (ACE) at a concentration of 50 μM. It has been shown to inhibit cyclase and other enzymes in vitro. The binding of this compound to ACE prevents the conversion of angiotensin I to angiotensin II, which is a potent vasoconstrictor. Hippuryl-His-Leu-OH also has inhibitory properties against atrial natriuretic peptide (ANP), and can be used as an antihypertensive agent. This drug has been shown to have growth factor β1 activities, and can be used for the treatment of cardiac diseases such as myocardial infarction. Structural analysis shows that this drug binds to the active site of ACE, inhibiting its activity by blocking access to substrate or by altering substrate specificity.</p>

<p>Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Leu-Leu-Nle (ZLL) is a small molecule that selectively inhibits the activity of the aspartyl protease, BACE1, which is an enzyme that cleaves amyloid precursor protein (APP) to produce amyloid beta peptides. The inhibition of this enzyme has been shown to be effective in preventing or delaying the onset of Alzheimer's disease. ZLL also inhibits estrogen receptor alpha and has antiestrogenic effects in breast cancer cells. This compound induces apoptosis by binding to apoptotic proteins, such as tumor necrosis factor receptor 1, Fas ligand, and TRAIL receptors. It also inhibits cell growth and induces chemoresistance in breast cancer cells.</p>

<p>PKI-tide is a potent, selective inhibitor of the calcium/calmodulin-dependent protein kinase. It inhibits the activity of this enzyme and prevents the activation of other protein kinases by this enzyme. PKI-tide binds to the ATP site of the calcium/calmodulin-dependent protein kinase and blocks the binding of ATP and calmodulin. This inhibition prevents the phosphorylation of target proteins, including myosin light chain in muscle cells.</p>

<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Abz-Ser-Pro-3-nitro-Tyr-OH is a chromophobe peptide that is expressed in renal cell carcinomas. It is a potent inhibitor of all three major classes of proteases: serine, cysteine and aspartyl proteases. Abz-Ser-Pro-3-nitro-Tyr-OH inhibits the activity of peptidases, which are enzymes involved in protein degradation and turnover. Abz has been shown to inhibit the activity of intrarenal proteolytic enzymes, including endopeptidase, metallopeptidase and aminopeptidase activities. Abz also has been shown to inhibit the expression of markers on the surface of kidney cells and to reduce renal cell proliferation.</p>

<p>Please enquire for more information about (D-His2,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe-Leu <br>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe is a synthetic substrate for κ opioid receptors. It also has antinociceptive properties and may be used as a potential analgesic drug. Dynorphin A (1-13) H-Tyr-Gly-Gly <br>Dynorphin A (1-13) H Tyr Gly Gly Phe Leu D Arg Arg Arg Ile Arg Pro Lys Leu Lys OH has been shown to be effective in the treatment of humans and rats with cardiac or physiological function problems. Dynorphin A (1 13) H Tyr Gly Gly Phe Leu D Arg Arg Arg Ile Arg Pro Lys Leu Lys OH increases serum prolactin levels in humans, which may indicate that it stimulates the hypothalamus to</p>

<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>

<p>L-Cystine dihydrochloride is a chemical compound that is used as an amino acid. It has biological properties that are due to its ability to inhibit pancreatic lipase and l-threonine. L-Cystine dihydrochloride has been shown to have anti-infectious effects against a number of bacterial and viral diseases, including HIV, herpes simplex virus, and influenza. L-Cystine dihydrochloride is also used in cell culture experiments because it can be used to break disulfide bonds in proteins.</p>

<p>3-Methylpyrazole is a heterocyclic compound that is an analogue of pyrazole. It has been shown to inhibit the growth of prostate cancer cells and may be used as an experimental model for human serum. 3-Methylpyrazole was able to decrease the expression of phosphorylated p38 mitogen-activated protein kinase (MAPK) in LNCaP cells. It also showed selectivity for group P2 protein kinases over group A, B, and C protein kinases. 3-Methylpyrazole is not active against methicillin resistant Staphylococcus aureus.</p>