Amino Acids (AA)

<p>H-Lys(Abz)-Pro-Pro-pNA is a potent and selective DPP-IV inhibitor that has been shown to be active in humans. This drug binds to the DPP-IV enzyme and prevents it from breaking down the incretin hormone, GLP-1, which is released by the intestine in response to food intake. This leads to increased insulin production and an improved glycemic profile in people with type 2 diabetes. H-Lys(Abz)-Pro-Pro-pNA also inhibits endoproteolysis of dipeptidyl peptidase IV (DPPIV), which reduces its activity against other enzymes such as amyloid beta protein precursor protein (APP) and angiotensin II receptor type 1 (AT1R).</p>

<p>Please enquire for more information about H-Arg(Pbf)-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Substance P (4-11) H-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a fluorescent peptide that binds to calcium and chloride ions. It has been shown to have an affinity for both peptide and calmodulin binding. This peptide has also been shown to be highly heat stable and can be used in a wide range of temperatures. The substance P (4-11) sequence is found in porcine, rat, bovine, and human proteins. The amino acid sequence is composed of 4 amino acids: proline, glutamine, phenylalanine, and leucine. This peptide's optimum pH is 7.5 with a temperature range of 35°C to 45°C. It has been shown that the activity of this peptide decreases as the concentration increases. It has also been shown to be susceptible to aminopeptidases at high concentrations or when</p>

<p>Homo-L-tyrosine hydrobromide (HLTB) is a prodrug that is converted to L-3,4-dihydroxyphenylalanine (L-dopa) in vivo. It is used as an immunomodulator by stimulating the immune system and reducing inflammation. HLTB has been shown to have anti-inflammatory effects on the production of cytokines and chemokines, which are important for tumor growth and metastasis. HLTB is also known to inhibit tyrosine kinase, which plays a role in the development of some cancers.</p>

<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>

<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>

<p>Z-Ala-Ile-OH is a hydroxamic acid that is used in peptide synthesis. It is a monomer that is hydrophobic and has an affinity for peptidyl acceptors. The synthetic method for Z-Ala-Ile-OH involves the use of aspartic acid and aspartate semialdehyde, which are used to synthesize the hydroxamic acid via an amidation reaction. The nomenclature of Z-Ala-Ile-OH is based on its structure and the order of amino acids found in it. Aspartic acid and asparagine are both amino acids found in Z-Ala-Ile-OH, with the -NH2 group being replaced by -OH in this particular molecule. This substitution results in a more hydrophobic compound than aspartate semialdehyde.</p>

<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Leu-Ala-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Gly-Ala-OH is a small molecule that regulates the replication of viruses. It was discovered by x-ray crystallography and has been shown to inhibit the replication of viruses in cell culture. H-Ala-Gly-Ala-OH effectively inhibits viral replication by binding to the protein that is required for viral RNA synthesis. This molecule also affects other cellular processes, such as regulating gene expression and DNA repair. The molecular orbital energies have been calculated using density functional theory and analysed using diffraction data from X-ray crystallography. H-Ala-Gly-Ala-OH binds to the virus's surface by electrostatic interactions with the phosphate backbone of the nucleic acid, preventing it from infecting cells. At low temperatures, HAAGAO can inhibit both DNA and RNA synthesis in vitro, but at higher temperatures it only inhibits RNA synthesis.</p>

<p>Please enquire for more information about Formyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide with a variety of physiological effects. It is formed by the cleavage of kininogen by kallikrein, and it is involved in the regulation of vascular tone and blood pressure, as well as responses to pain and inflammation. Bradykinin stimulates the release of histamine from mast cells, which causes an inflammatory response. Bradykinin also has been shown to stimulate the release of leukotrienes, prostaglandins, and cytokines from human lung tissue. The interaction between bradykinin and its receptors has been studied extensively using in vitro assays. The conformational changes in this peptide have been characterized by spectroscopic studies such as nuclear magnetic resonance (NMR) and circular dichroism (CD). In addition, bradykinin can be detected using luminescence techniques such as chemiluminescence or bioluminescence. Studies have shown that micromolar concentrations of bradykinin</p>

<p>H-Gly-Arg-OH is a hydrophobic molecule that is structurally similar to the amino acid composition of casein. It has been shown to be an efficient method for the isolation of casein from milk. H-Gly-Arg-OH binds reversibly to casein and can be used as a reagent in immunoaffinity chromatography and filtration. The residue obtained after enzymatic activity can be used for polyacrylamide gel electrophoresis.</p>

<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The compound Fmoc-D-Cys(Bzl)-OH is a chiral homologue of the protonated amino acid D-Cys. The configuration of the proton in this molecule has been determined by proton nmr experiments. This compound is synthesized from the racemic mixture by reductive amination and deprotonation with sodium borohydride. The reagents are an organophosphate and an ester, which react in order to form a new carbon-carbon bond. The postulated enantiomers are screened for their activity against phospholipase A2, which cleaves ester bonds on phospholipids. One enantiomer has been shown to have more potent activity than its counterpart, suggesting that it is the desired product.</p>

<p>Boc-Pro-Pro-Pro-Pro-OH is a synthetic peptide. It has been shown to have high specificity and is useful in the diagnosis of diseases that are caused by abnormal extracellular glutamic acid, hydroxyproline, or ion-exchange. Boc-Pro-Pro-Pro-Pro-OH has been used as a model for other peptides and has been shown to have acidic properties. The structure is dodecyl peptidic with a residue of -N(CH2)3-.</p>

<p>Please enquire for more information about (Nle 10)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asn-Pro-Glu-Tyr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Methyl-1-cyclohexanecarboxylic acid is a fatty acid that is present in the conjugates of natural and synthetic oils. It is an unsaturated fatty acid with a cycloalkane ring structure. The synthesis of 1-methyl-1-cyclohexanecarboxylic acid has been shown to be catalyzed by a carboxylase, which converts acetyl CoA into malonyl CoA. This reaction is irreversible and can be used as the first step in the biosynthesis of fatty acids. 1-Methyl-1-cyclohexanecarboxylic acid has been shown to cause cell death in leukemia cells, as well as inhibit epileptic seizures in rats.</p>

<p>Please enquire for more information about Minigastrin I tifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-Gln-OH is an amide that is a major metabolite of the hormone prolactin. It is generated by deamination, which converts the amino acid histidine to H-Ile-Gln-OH. H-Ile-Gln-OH has been shown to have an antiinflammatory effect on colitis and cardiac reperfusion injury. Its mechanism of action may be due to its ability to inhibit proinflammatory cytokines such as IL1β and TNFα.</p>

<p>Suc-Ala-Ala-Pro-Val-AMC is a protease inhibitor that inhibits serine proteases by binding to the reactive site. It has been shown to inhibit prorenin, a renin enzyme that is involved in the regulation of blood pressure and kidney function. Suc-Ala-Ala-Pro-Val-AMC has also been shown to inhibit thrombin, which is involved in blood coagulation, and neutrophil elastase, which is responsible for the degradation of elastin fibers. Suc-Ala-Ala-Pro-Val-AMC has been shown to be effective against babesiosis, an infection caused by the protozoan parasite Babesia microti. This drug is expected to have a neutral pH and high detection sensitivity when used in clinical settings.</p>

<p>4-Methoxy-3-(trifluoromethyl)benzoic acid is a useful scaffold that can be used as a building block for the synthesis of complex compounds. It has been shown to react with various reagents and is a versatile building block that can be used in organic synthesis. 4-Methoxy-3-(trifluoromethyl)benzoic acid is a high quality chemical and has been classified as speciality chemicals. This product is also known by the CAS number 213598-09-5.</p>

<p>Please enquire for more information about H-D-Ser(SO3H)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-2-Hydroxyethyl-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PTH-Related Protein (1-34) is a potent antagonist of the PTH/PTHrP receptor, which belongs to the family of peptide hormones. It can be used for the treatment of osteoporosis and certain types of cancer. It inhibits bone resorption by binding to the receptor in bone cells and blocking PTH/PTHrP-induced activation of phosphaturic acid phosphatase. This drug also inhibits the production of insulin-like growth factor I (IGF-I) and its receptors, which may lead to an anti-cancer effect. PTH-Related Protein (1-34) has been shown to have a high specificity for the PTH/PTHrP receptor, with moderate affinity for other receptors such as glucagon and somatostatin. The peptide is amphipathic, meaning it has both hydrophilic and hydrophobic regions. This characteristic allows it to penetrate cell membranes more easily than other</p>

<p>Please enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Phenylpropionic acid is a reactive chemical that can be synthesized by an asymmetric process. It has been used in the synthesis of nonsteroidal anti-inflammatory drugs, as it inhibits the activity of cyclooxygenase and lipoxygenase enzymes. This chemical also binds to the hydroxyl group on target proteins, inhibiting their function. 2-Phenylpropionic acid is metabolized by microbial metabolism and can inhibit the activity of drug-metabolizing enzymes such as CYP3A4 and CYP2D6. It may also interact with other drugs that are processed by these enzymes, including warfarin and carbamazepine. 2-Phenylpropionic acid is a competitive inhibitor that binds to the active site of an enzyme and blocks its access to its substrate molecule. The binding of 2-phenylpropionic acid to enzyme's active site prevents the reactant from entering and reacting with the enzyme, thereby preventing a</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A is a peptide that belongs to the class of opioid peptides. It acts as a kappa-opioid receptor agonist and is involved in the transmission of pain signals and other information from the central nervous system to the peripheral nervous system. Dynorphin A has been shown to inhibit the release of neurotransmitters, such as acetylcholine, dopamine, serotonin, and norepinephrine. It also blocks the action of transmitters at postsynaptic membranes by binding to their receptors. Dynorphin A binds with high affinity to kappa-opioid receptors and can be used for treatment of heroin addiction and chronic pain.</p>

<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Alternariol-9-methyl ether is a natural compound that has been shown to have significant cytotoxic effects on murine hepatoma cells. This compound also synergizes with anti-retroviral drugs and has been found to be capable of inducing apoptosis in HIV-infected T cells at low concentrations. Alternariol-9-methyl ether is structurally related to the polycyclic aromatic hydrocarbons, such as alternariol, which are only weakly toxic to mice but are potent pro-apoptotic proteins when bound covalently to DNA. Structural analysis of this compound revealed that it inhibits the binding of a pro-apoptotic protein (Bid) to its target site on dsDNA, preventing Bid from initiating apoptosis. It is thought that this effect may be responsible for its synergistic interaction with active antiretroviral therapy.</p>

<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>

<p>Please enquire for more information about For-Met-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-His(Fmoc)-OPfp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bifunctional Antiplatelet Agent H(-Lys-Arg)3-Arg-Gly-Asp-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ser-Leu-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Met-Enkephalin is a hexapeptide that is derived from the amino acid Met. It is related to the opioid peptide Met-enkephalin, which has been shown to be involved in pain modulation and emotional responses such as fear and pleasure. Boc-Met-Enkephalin was synthesized by coupling two different fragments through an amide bond. The sequential order of these fragments was determined by high-resolution NMR spectroscopy. The carbonyl groups on the peptides were identified by using heteronuclear 2D correlation experiments. This sequence of carbons was demonstrated with 13C and 15N spectroscopy, in which it was found that there are three molecules of methylene carbon per molecule of Boc-Met-Enkephalin.</p>

<p>H-Leu-NHOH·TFA is a histidine analogue that is used as a catalyst. It has been shown to be an effective inhibitor of corynebacteria, and can be used in the synthesis of fatty acids, which are important for cell membrane production. H-Leu-NHOH·TFA also binds to the enzyme synthetase and inhibits its activity, which blocks the conversion of ammonia and amino acids into polypeptides. This inhibition prevents bacterial growth. H-Leu-NHOH·TFA is active at acidic pH levels, with a maximum activity at pH 4.0. The optimum temperature for this compound is 50°C, but it will still work at temperatures up to 60°C.</p>

<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Gly-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (44-59) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Val-Asp-Val-Ala-Asp-aldehyde is a pseudo acid that is used in molecular modeling and kinetic studies. Ac-Val-Asp-Val-Ala-Asp-aldehyde has been shown to be a potent inhibitor of caspase activity and has been shown to inhibit the activity of various other enzymes as well, including cyclohexane ring hydroxylases and nitroreductases. Ac-Val-Asp-Val-Ala-Asp--aldehyde analogs are being studied for their ability to bind to specific proteins or inhibit enzyme activities. Ac-- Val-- Asp-- Val-- Ala-- Asp-- aldehyde binds to the active site of caspase 3 and prevents it from cleaving its target protein, which leads to cell death.</p>

<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,5-Dichloro-4-methylpyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.</p>

<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>

<p>Please enquire for more information about Big Endothelin-1 (porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Gly-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 env Protein gp41 (1-23) amide (isolates BRU/JRCSF) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>

<p>Please enquire for more information about Tyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Steroidogenesis-Activator Polypeptide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amylin is a peptide hormone that belongs to the group of hormones that include insulin and glucagon. Amylin has been shown to have an anti-diabetic effect in diabetic patients by stimulating insulin secretion and improving insulin sensitivity. Amylin inhibits protein aggregation, which may be due to its ability to form hydrogen bonds with other amyloid protein molecules. The structural biology of amylin has been studied using NMR spectroscopy and silver ions. This molecule has a sequence of H-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser, with a molecular weight of 3,726 Da.</p>

<p>Ac-Ile-Glu-Thr-Asp-PNA is a synthetic peptide that mimics the amino acid sequence of a region in the protein p67phox, which is a component of the mitochondrial membrane. Ac-Ile-Glu-Thr-Asp-PNA induces apoptosis by activating caspases and inhibiting ATP production. In vitro studies have shown this peptide to be active against hl60 cells, an inflammatory bowel disease cell line, as well as carcinoma cell lines derived from squamous cell carcinoma and carcinoma of the cervix. Ac-Ile-Glu-Thr-Asp-PNA also inhibits inflammatory cytokines such as IL1β, TNFα and IL6, which are associated with chronic inflammation.</p>

<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pyr 110)-Prepro-Urotensin II (110-123) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-(R)-2-methoxyphenylglycine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H(-Asn-Pro-Asn-Ala)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Asp-Tyr(PO3H2)-Val-Pro-Met-Leu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ala-Cys(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Leu-OH is a synthetic peptide that is used as a substrate for proteases. It contains the amino acid sequence Gly-Leu-OH and has been shown to inhibit serine proteases with irreversible inhibition. Z-Gly-Leu-OH inhibits protease activity by binding to the enzyme's active site, which prevents it from catalyzing reactions and stabilizing the product of the reaction. The substrate can be cleaved by a protease in two ways: (1) hydrolysis of the amide bond between Gly and Leu or (2) protonation of the amide bond between Gly and Leu followed by elimination of water. These reactions are reversible because they are dependent on pH. In order to measure enzyme activity using this substrate, it must be conjugated with a fluorescent dye so that fluorescence can be detected following cleavage.</p>

<p>Please enquire for more information about (Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Gly-Pro-Phe-pNA is an amide that has been synthesized for the stabilization of proteins, peptides and nucleic acids. It has shown to be effective in preventing isomerization of casein and phosphatase (casein kinase II) by stabilizing the alpha helix structure. Suc-Ala-Gly-Pro-Phe-pNA also prevents fk506 binding to endoplasmic reticulum protein tyrosine kinases and isomerizes tyrosine to phenylalanine. The tetrapeptide sequence has been shown to be similar to sequences found in cellular proteins. This compound is a synthetic analog of the natural amino acid proline and can be used as a substitute in peptides or nucleotide sequences, due to its ability to stabilize these molecules against proteolysis or hydrolysis.</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Ile-Tyr-Gly-Glu-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>H-Lys-Gly-Glu-OH is a peptide that binds to epidermal growth factor, increasing the production of new cells. This molecule has been shown to inhibit the growth of viruses, such as herpes simplex virus, and matrix metalloproteinase. This peptide also interacts with toll-like receptor 4, which is a protein that recognizes lipopolysaccharides in Gram-negative bacteria. Titration calorimetry has shown that H-Lys-Gly-Glu-OH has an effect on epidermal growth factor, which may be due to its effects on fatty acid metabolism or growth factors.</p>

<p>Please enquire for more information about Proadrenomedullin (12-20) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin A (1-8)-Melittin (1-18) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glutamine is a non-essential amino acid that is found in the cell in large amounts. It functions as a precursor of glutamate, an important neurotransmitter and intermediate in protein synthesis. Glutamine also has antioxidant properties, which may be due to its ability to donate hydrogen atoms or act as a reducing agent. Glutamine can be synthesized by glutaminase from glutamate and ammonia, but it can also be obtained from dietary sources. The uptake of glutamine is rapid at low concentrations, but becomes slower at higher concentrations. Glutamine is catabolized by the liver and kidney into glutamate and ammonia.<br>Glutamate dehydrogenase (GLDH) catalyzes the conversion of glutamate to α-ketoglutarate, producing NADH and H+.<br>The genetic mechanisms underlying the synthesis of glutamine are not well understood; however, one hypothesis states that glutamine could be synthesized from alpha-ketoglutarate via the reverse transamination reaction during periods when glucose</p>

<p>1-(4-Hydroxy-3-methoxyphenyl)-2-nitroethene is an experimental molecule that was not previously known to exist. The intramolecular reaction of 1,4-dihydroxynitrobenzene and glyoxylic acid yields the product. It is a phenolic compound with biological activity, which has been shown to inhibit glycosidases and alkaloids.</p>

<p>Please enquire for more information about (D-Pro2,D-Trp6·8, Nle 10)-Neurokinin B including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr(tBu)-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>