Amino Acids (AA)

<p>Please enquire for more information about H-D-Met-Met-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Gly-Gly-Gly-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Alanine benzyl ester hydrochloride is a conjugate of L-alanine and the quaternary ammonium salt benzyl ester hydrochloride. The water molecule is attached to the nitrogen atom in the benzyl ester. It has been shown to inhibit viral replication by interfering with the virus' ability to use host enzymes and proteins for synthesis. L-Alanine benzyl ester hydrochloride has significant cytotoxicity against leukemia cells, which may be due to its ability to inhibit rna polymerase activity. L-Alanine benzyl ester hydrochloride can also be used as an inhibitor of angiotensin converting enzyme (ACE), which is important in regulating blood pressure.</p>

<p>Ac-Tyr-Val-Ala-Asp-aldehyde is a sesquiterpene lactone that has been shown to have anti-inflammatory properties. It inhibits the inflammatory response by inhibiting the production of pro-inflammatory cytokines and chemokines, such as IL1β, IL6, and TNFα. Ac-Tyr-Val-Ala-Asp-aldehyde also inhibits the activity of cyclooxygenase 2 (COX2) and lipoxygenase (LOX), which are enzymes that produce prostaglandins from arachidonic acid. Acetylsalicylic acid is an example of a drug with similar properties. Acetylsalicylic acid has been shown to inhibit the growth of cancer cells in tissue culture studies and in animal models. This compound may also be used to treat bowel disease, congestive heart failure, or other diseases that are characterized by increased apoptosis.</p>

<p>Disulfide bond is an analytical method for the determination of the concentration-time curve. It is a cyclic peptide that competes with fibrinogen for binding to platelets. Disulfide bond has been shown to be an antagonist of receptor antagonist, and has potential applications in the treatment of autoimmune diseases. Disulfide bond can also be used as a model system for toxicological studies and experimental models in humans.</p>

<p>Z-Ala-Val-OH is a prodrug that is hydrolyzed to ala-z-valine in vivo. It has been shown to be resistant to enzymes such as esterases, amidases, and proteases. Z-Ala-Val-OH has been modified in an effort to increase its affinity for the active site of the enzyme. This modification involves attaching a hydrophobic group onto the amide nitrogen of the amino acid residue. The resulting product is an active ester that can be used as an antihypertensive drug or for the treatment of Alzheimer's disease.</p>

<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.</p>

<p>Please enquire for more information about Fmoc-Lys(biotinyl)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Chloro-2-iodo-phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about For-Met-Leu-p-iodo-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Aloc-Ala-OH·DCHA is a linker that can be utilized in nucleotide synthesis. It is synthesized by reacting the amine group of alanine with the acid chloride of DCHA. The product of this reaction, Aloc-Ala-OH·DCHA, is an amide bond with a free hydroxyl group on one end and a free amino group on the other end. The C-terminal carboxylic acid function of this compound reacts with phosphoramidite to yield the desired n-terminal threonine residue. This linker can also be used to conjugate other compounds such as nucleosides or phosphodiester bonds.</p>

<p>Spantide I is a peptide that is a member of the Galanin family. It has been shown to have a proliferative effect on retinal cells in vitro, and may be effective in treating diabetic retinopathy. Spantide I also inhibits the production of pancreatic enzymes and choroidal neovascularization. It is a diagnostic marker for cancer and other diseases, as well as being used in the treatment of hepatitis. The sequences for Spantide I are GG-S-P-A-N-T-I-D-E--I--H--Gly--Trp--Thr--Leu--Asn--Ser--Ala--Gly--Tyr--Leu--Leu---Gly---Pro---D----Arg---Pro-----Lys---Pro-------Gln-------D------Trp------Phe------D------Trp------Leu-------Leu-----NH2</p>

<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>

<p>Dolastatin 15 (5S)-1-[(2S)-O-(N,N-Dimethyl-Val-Val-N-Me-Val-Pro-Pro)-2-hydroxyisovaleryl]-2-oxo-4-methoxy-5-benzylpyrrolidinium is a natural compound that has been isolated from the Indian Ocean sea hare Dolabella auricularia. It has shown significant cytotoxicity against cancer cells as well as significant immunosuppressive activities in animals. Dolastatin 15 is an analog of dolastatin 10 and has been shown to be active against hepatitis B and C virus. It also has antiinflammatory properties and may be effective in combating autoimmune diseases. The synthesis of this compound is an asymmetric synthesis with a hydroxyl group on one side of the molecule and an amide on the other side.</p>

<p>Z-Gly-Leu-NH2 is a synthetic peptide that has been designed to mimic the amino acid sequence of casein. It is a metalloendopeptidase inhibitor and can be used in the synthesis of proteins. Z-Gly-Leu-NH2 inhibits the activity of subtilisin, which is a proteolytic enzyme. The inhibition of subtilisin by Z-Gly-Leu-NH2 prevents the hydrolysis of peptide bonds in protein substrates. This inhibition leads to an increase in molecular weight and molecular weight distribution, as well as an increase in the number of high molecular weight peaks on chromatograms. This peptide also has serine protease inhibitory activity and can be used as a synthetic substrate for kinetic studies.</p>

<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>

<p>H-Phe-Phe-Phe-Phe-Phe-OH is a peptide that inhibits the protease dpp-iv. It is a potent inhibitor of dpp-iv, with an IC50 value of 0.2 μM. H-Phe-Phe-Phe-Phe-Phe-OH is not active against other proteases, such as papain and cathepsin B, and it does not inhibit the activity of pepsin. The inhibition effect of HFPHP has been shown to be dose dependent. Inhibition of dpp-IV by HFPHP leads to inhibition of the activation of other proenzymes such as trypsin and chymotrypsin, which are required for protein digestion in the stomach.</p>

<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about L-allo-Threoninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lysine acetimidate is a reactive compound that can be activated by the addition of an acid. Lysine acetimidate is a potent activator of macrophages and other inflammatory cells. It has been used in experimental models to study bowel disease and repair mechanisms. In these models, lysine acetimidate has shown to have anti-inflammatory effects, which may be due to its ability to decrease the production of pro-inflammatory cytokines by immune cells. The metabolic disorder caused by lysine acetimidate is still being studied. Lysine acetimidate also has immunomodulatory effects, as it can inhibit the synthesis of epidermal growth factor (EGF) in lung cells and cause damage to alveolar type II cells in the lung.</p>

<p>Vasopressin is a peptide hormone that regulates water balance. It is synthesized in the hypothalamus and stored in the posterior pituitary gland, from where it is released when blood pressure falls. Vasopressin binds to V1 receptors in the kidney and vascular smooth muscle cells, causing vasoconstriction and increased blood pressure. Vasopressin also stimulates phosphatidic acid synthesis and hypotension, which are mediated through V2 receptors. Vasopressin has been found to be effective against cardiac arrest and myocardial infarction in animals. This drug has also been shown to stimulate the paraventricular nucleus of the hypothalamus and inhibit sympathetic activity in ganglia.</p>

<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>

<p>Please enquire for more information about (Ala92)-Peptide 6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Asp-Asn-Gln-OH is a basic amino acid that is cleaved by endopeptidase to form H-Asp, H-Asn, and H-Gln. It is also cleaved by serine proteases to form the amino acid residues of arginyl, aspartyl, and glutamyl. The residue sequence can be determined through hplc analyses of microsomal proteins. This amino acid has been shown to have a regulatory effect on the metabolism of other amino acids in rat liver cells. Asparaginyl and glutamyl are essential for the synthesis of proproteins.</p>

<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Phenylacetyl-(D-Arg2·28,p-chloro-Phe6, Homoarg 9·29,Tyr(Me)10, Abu 15, Nle 27)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH is a nucleic acid sensor that can be used to detect the presence of specific nucleic acids (DNA or RNA) in a sample. Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH binds to nucleic acids, and then emits fluorescence when irradiated with light at a wavelength of 350 nm. Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH can be used as an assay for the detection of specific DNA sequences, such as those found in single nucleotide polymorphisms (SNPs).</p>

<p>Please enquire for more information about Z-Glu-Leu-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Ala-Lys-OH hydrochloride salt is a tripeptide with a reactive side chain. The protonated form of the molecule can be analyzed by acid analysis, and the ligand can be synthesized in a laboratory. Amino acid analysis has shown that this tripeptide contains lysine residues, which are important for binding to the peptide transporter. This compound is taken up through the intestine and is found in porcine tissue. H-Ala-Ala-Lys-OH hydrochloride salt has been used as a model compound in structural studies of peptide transporters.</p>

<p>Please enquire for more information about For-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Leu-Leu-Leu-OH is a pentapeptide that is used in cancer treatment to inhibit the growth of cancer cells. It prevents the production of proteins and, as a result, cell division. Leu-Leu-Leu-OH has been shown to be effective against tumor cells with an antibody that binds to the surface of cells. The monoclonal antibody is taken up by the cancer cells through receptor mediated endocytosis, which leads to inhibition of protein synthesis and cell death.</p>

<p>Please enquire for more information about H-Asp(His-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ACTH (34-39) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MPLP(139-151) is a peptide that is derived from the myelin proteolipid protein (PLP). MPLP(139-151) has been shown to inhibit macrophage inflammatory in vitro and brain inflammation in vivo. The inhibition of macrophages was mediated by the induction of apoptosis and inhibition of NF-κB. MPLP(139-151) also induced regression of experimental autoimmune encephalomyelitis in mice, which suggests that it might be useful as a therapeutic agent for multiple sclerosis or other inflammatory diseases.</p>

<p>Please enquire for more information about H-Glu-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Trp-Leu-OH is a tryptophan protease that has been shown to have aminopeptidase activity. It can be used in the treatment of intestinal inflammation, as well as other conditions where it is desirable to reduce the concentration of amino acid precursors. The oxidation products of H-Leu-Trp-Leu-OH are antigenic and can be used for the detection of this enzyme in biological fluids. Hplc analysis can identify tripeptides formed by H-Leu-Trp-Leu-OH, which are then cleaved by other enzymes. This process creates a radioactive product that can be detected using radiation or microscopy. Immunoaffinity chromatography is also able to isolate H-Leu-Trp-Leu-OH from biological fluids. Monoclonal antibodies against this enzyme have been shown to inhibit ectoenzymes such as lipases and phospholip</p>

<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Ala-Val-pNA (Suc-AAV-pNA) is a specific substrate for human and rat neutrophil elastases.</p>

<p>H-Ile-Pro-OH is an amino acid that is a constituent of sphingolipids, which are important for the metabolism of lipids and other biological substances. H-Ile-Pro-OH can be found in casein as well as oxidation products of casein. It has been used in diagnostic tests to measure levels of hippuric acid in plasma samples. The dietary intake of H-Ile-Pro-OH can be determined by measuring the concentration of this amino acid in plasma samples. Synthetic H-Ile-Pro-OH can also be used for studies on the metabolism of tryptophan. This amino acid has been shown to inhibit chloride ion transport across the cell membrane and fatty acid synthesis, as well as proteolysis and protein degradation by pancreatic enzymes.</p>

<p>Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Pro-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Asn-OH is a bioassay that was developed to determine the amount of ryegrass in perennial ryegrass. This compound is synthesized by hydrolysis of cellulose acetate, which is used as a substrate. H-Ala-Asn-OH has been shown to inhibit the growth of E. coli and S. aureus and has been shown to have hematological, high performance liquid chromatography, and reversed phase high performance liquid chromatography properties. The gene product for this compound is expressed by perennial ryegrass.</p>

<p>Please enquire for more information about Fmoc-D-Lys(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Gly-His-OH is a synthetic amino acid that has been shown to bind to metal ions such as copper and zinc. The interaction with the metals may be due to the presence of the carboxyl group on the side chain. Z-Gly-Gly-His-OH is also able to catalyze the hydrolysis of ester bonds in organic solvents, which may be due to its interactions with cations. Z-Gly-Gly-His-OH can also interact with enzymes such as protein kinases, leading to changes in enzyme activity.</p>

<p>Boc-D-Phe-Pro-Arg-OH is a receptor binding molecule that belongs to the family of serine proteases. It has been shown to be reactive with multi-walled carbon nanotubes and fatty acids, making it useful for analytical chemistry, processing and amplification. The Boc-D-Phe-Pro-Arg-OH molecule binds to carbohydrate molecules in a way that mimics the action of an enzyme. This binding activates markers and triggers a reaction that produces hydrogen bonds between the target and the substrate. Boc-D-Phe-Pro-Arg-OH has been shown to have high affinity for serine protease receptors.</p>

<p>Please enquire for more information about Acarbose 1,1-a,a-glycoside including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Phe-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiotensin (1-12) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>

<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>

<p>N-Methyliminodiacetic acid is a monosodium salt that is produced by the reaction of methylamine and malonic acid. It has been shown to have an inhibitory effect on enzymes and metabolic rates in the human body. The structure of N-methyliminodiacetic acid contains a hydroxyl group, which can form hydrogen bonding interactions with nitrogen atoms in proteins, forming a chelate ligand. This type of binding is thought to be responsible for its ability to inhibit enzyme activities and metabolic rate.</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.</p>

<p>Kentsin H-Thr-Pro-Arg-Lys-OH is a synthetic peptide that is used as a conditioning agent in vitro and in vivo. It was initially developed as an anti-viral to combat HIV, but has been found to possess contraceptive properties. Kentsin H-Thr-Pro-Arg-Lys-OH inhibits the proliferation of human granulosa cells by blocking ovulation and interfering with the regular development of ovarian follicles. It has been shown to be effective against Pim1, a progesterone receptor on granulosa cells. The concentration response curve for Kentsin H-Thr-Pro-Arg Lys OH shows that it can inhibit ovulation at concentrations as low as 1 μM.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Methyl-L-tryptophan is an activated form of the amino acid tryptophan. It has been shown to have immunomodulatory effects that are mediated by its ability to inhibit IDO1, which is an enzyme that regulates the production of inflammatory cytokines. 1-Methyl-L-tryptophan has been shown to reduce the severity of abdominal surgery in mice and exhibits anticancer activity against a variety of cancer cells. 1-Methyl-L-tryptophan also has antiemetic properties, as it has been shown to block the activation of 5HT3 receptors in the brainstem. This drug also activates polymerase chain reaction (PCR) and inhibits DNA synthesis by binding directly to DNA polymerase.</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>

<p>Please enquire for more information about Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Val-Fmoc)-OH is a biomolecule that is used for the synthesis of peptides. It has been shown to be an efficient synthetic method for the synthesis of peptides and isopeptides. The use of this biomolecule in peptide synthesis allows for the production of large quantities of peptides without racemization or epimerization that can occur with other methods. This synthetic method provides a means to produce both amino acid and dipeptide sequences, as well as the incorporation of non-natural amino acids.</p>

<p>N-Benzoyl-N-phenylhydroxylamine is a compound that has been shown to be an optimum concentration for the production of molybdenum. It is a model system for the extraction and separation of molybdenum from other metals. The extraction process involves acidification with nitric acid, followed by precipitation with sodium benzoate. N-Benzoyl-N-phenylhydroxylamine is extracted using an electrode and then purified with a metal chelate. This compound has been shown to have synergistic effects when combined with vanadium, which may be due to their similar chemical properties.</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(D-Val13)-alpha-MSH (11-13) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-2-Ethoxyethyl-Val-Ala-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-Val-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>

<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide 74 is a synthetic drug that has been shown to inhibit the activity of matrix metalloproteinases, which are enzymes that break down collagen in the extracellular matrix. This peptide also inhibits cell invasiveness and migration. It has been shown to be effective at inhibiting cancer cell growth, although it does not affect normal cells. The peptide is a receptor for the LDL-receptor and inhibits LDL uptake into macrophages. The peptides have also been shown to inhibit angiogenesis and tumor growth in animals by blocking VEGF receptors.</p>

<p>Please enquire for more information about H-D-Leu-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>

<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>

<p>Please enquire for more information about FMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>

<p>Hymenistatin I is a cyclic peptide that is synthesized from the natural amino acid L-proline. It has been shown to inhibit tumor growth and is used in the treatment of bladder cancer. The synthesis of Hymenistatin I begins with the protection of proline as an N-tert-butyloxycarbonyl derivative, followed by a sequence of coupling reactions. This synthetic process involves the use of a linker, such as tetrazole or succinimidyl ester, for example. The final product can then be purified by HPLC analysis. Hymenistatin I inhibits calcineurin inhibitor, which are immunosuppressive agents that are used to treat lymphocytic leukemia and other autoimmune diseases.</p>

<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>