
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,436 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38216 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS:<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>Formula:C38H57N15O11SPurity:Min. 95%Molecular weight:932.02 g/molMeOSuc-Lys(2-picolinoyl)-Ala-Pro-Val-pNA
CAS:<p>Please enquire for more information about MeOSuc-Lys(2-picolinoyl)-Ala-Pro-Val-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H48N8O10Purity:Min. 95%Molecular weight:752.81 g/mol(D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H95N19O13Purity:Min. 95%Molecular weight:1,338.56 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Des-Gly10,D-Trp6,Pro-NHEt 9)-LHRH (sea bream)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Trp6,Pro-NHEt 9)-LHRH (sea bream) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H76N14O13Purity:Min. 95%Molecular weight:1,213.34 g/mol(Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated)
CAS:<p>Please enquire for more information about (Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H74N14O18SPurity:Min. 95%Molecular weight:1,251.33 g/molSapecin
CAS:<p>Sapecin is an antimicrobial peptide, which is derived from the hemolymph of the silk moth (Bombyx mori) with potent bactericidal action. The source of Sapecin is the immune system of the silk moth, where it acts as a natural defense mechanism against microbial infections. Its mode of action involves disrupting bacterial cell membranes, leading to cell lysis and death. The peptide achieves this by inserting itself into the lipid bilayer, creating pores that compromise the structural integrity of the membrane.</p>Formula:C164H266N58O52S6Purity:Min. 95%Molecular weight:4,074.62 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molZ-Asp-Gln-Met-Asp-AFC
CAS:<p>Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H39F3N6O13SPurity:Min. 95%Molecular weight:852.79 g/molBz-DL-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Bz-DL-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H25N5O4·HClPurity:Min. 95%Molecular weight:471.94 g/mol2-Chloro-3-methoxybenzaldehyde
CAS:<p>Please enquire for more information about 2-Chloro-3-methoxybenzaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H7ClO2Purity:Min. 95%Molecular weight:170.59 g/molDecanoyl-Arg-Val-Arg-Lys-chloromethylketone
CAS:<p>Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is a potent activin antagonist that has been shown to inhibit follicle development in ovary cells. It also blocks the protease activity of leishmania, which is a parasite that causes cutaneous leishmaniasis. This drug binds to proteases and inhibits their activity by competing with substrates for the active site. Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is not expressed in the submandibular gland or the submaxillary gland, which are salivary glands.</p>Formula:C34H66ClN11O5Purity:Min. 95%Molecular weight:744.41 g/molZ-Pro-Leu-Gly-OEt
CAS:<p>Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le</p>Formula:C23H33N3O6Purity:Min. 95%Molecular weight:447.52 g/molMCH-Gene-Overprinted-Polypeptide-14 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H132N22O18S3Purity:Min. 95%Molecular weight:1,786.24 g/molN-Methyl-1,2-phenylenediamine dihydrochloride
CAS:<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>Formula:C7H12Cl2N2Purity:Min. 95%Color and Shape:PowderMolecular weight:195.09 g/mol(Arg8)-Conopressin G trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H71N17O10S2Purity:Min. 95%Molecular weight:1,062.28 g/molACTH (7-38) (human)
CAS:<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Formula:C167H257N47O46Purity:Min. 95%Molecular weight:3,659.12 g/molZ-N-Me-D-Ser(tBu)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-N-Me-D-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H23NO5·C12H23NPurity:Min. 95%Molecular weight:490.68 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/molH-Pro-His-Phe-OH
CAS:<p>H-Pro-His-Phe-OH is a proteolytic enzyme that belongs to the group of serine proteases. It is a member of the subtilisin family and has been used in research for its ability to cleave proteins at random. H-Pro-His-Phe-OH has been shown to hydrolyze lactococcal proteinase and other serine proteases, such as trypsin, chymotrypsin, and elastase.</p>Formula:C20H25N5O4Purity:Min. 95%Molecular weight:399.44 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/molH-Arg-Ala-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Ala-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H20N6O2·2HClPurity:Min. 95%Molecular weight:317.22 g/molH-β-Chloro-Ala-NHOH hydrochloride salt
CAS:<p>Please enquire for more information about H-beta-Chloro-Ala-NHOH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C3H7ClN2O2Purity:Min. 95%Molecular weight:138.55 g/molH-Arg-Tyr-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Tyr-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N6O3·2HClPurity:Min. 95%Molecular weight:409.31 g/mol(Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molZ-Gly-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Z-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H37N7O7·HClPurity:Min. 95%Molecular weight:656.13 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H54NO8PSi2Purity:Min. 95%Molecular weight:932.15 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molFA-Ala-Arg-OH
CAS:<p>F-Ala-Arg-OH is a peptide hormone that has been shown to have antitumor, antiinflammatory, and antidiabetic properties. The peptide hormone binds to the creatine kinase enzyme and inhibits its activity, which leads to a decrease in phosphocreatine levels in the human serum. F-Ala-Arg-OH does not inhibit lysine residues of the creatine kinase enzyme. This inhibition can be reversed by adding ATP or adding an activator. F-Ala-Arg-OH also inhibits cancer cells through apoptosis. This inhibition of cancer cells may be due to the ability of this peptide to bind to lysine residues on cell membranes and activate them. F-Ala-Arg-OH is also able to destroy tumor cells by binding to their mitochondria and inducing their lysis.</p>Formula:C16H23N5O5Purity:Min. 95%Molecular weight:365.38 g/molAloc-Ser-OMe
CAS:<p>Aloc-Ser-OMe is an enzyme that catalyzes the cleavage of 1,4-linked alpha-D-galactosides. It has been shown to be a useful reagent for the synthesis of alkyl glycosides. Aloc-Ser-OMe can be used in enzymatic synthesis or chemoenzymatic synthesis. This enzyme has excellent stereospecificity and is quantitatively active at pH 4.5 to 5.0 and at temperatures ranging from 20°C to 40°C. The enzyme can also catalyze transglycosylation reactions with beta-glucosidase, producing galactoarabinan oligosaccharides with various degrees of polymerization.</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/molSPLUNC1 (22-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O25Purity:Min. 95%Molecular weight:1,815.08 g/mol4-Amino-5-methoxy-2-methylbenzenesulfonic acid
CAS:<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>Formula:C8H11NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:217.24 g/molFmoc-D-proline
CAS:<p>Please enquire for more information about Fmoc-D-proline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H19NO4Purity:Min. 95%Molecular weight:337.37 g/molFmoc-[15N]Leu-OH
CAS:<p>Fmoc-[15N]Leu-OH is a research chemical that has various applications in the field of biosynthesis and antibody production. It is commonly used in peptide synthesis and as a building block for the preparation of peptides and proteins. Fmoc-[15N]Leu-OH is known for its high purity and quality, making it an ideal choice for researchers and scientists working in the field of molecular biology. This compound can be easily dissolved in ethanol or other organic solvents, allowing for convenient use in laboratory experiments. With its unique characteristics and wide range of applications, Fmoc-[15N]Leu-OH is a valuable tool for those involved in biochemical research.</p>Formula:C21H23NO4Purity:Min. 95%Molecular weight:354.41 g/molAnthranilyl-HIV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H65N13O11Purity:Min. 95%Molecular weight:940.06 g/mol(Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H114N32O13SPurity:Min. 95%Molecular weight:1,499.8 g/mol(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat)
CAS:<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H254N50O36Purity:Min. 95%Molecular weight:3,478.07 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/mol1,2-Distearoyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>Formula:C44H88NO8PPurity:Min. 95%Molecular weight:790.15 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molZ-Asp-Glu-Val-Asp-chloromethylketone
CAS:<p>Z-Asp-Glu-Val-Asp-chloromethylketone is a reactive compound that inhibits the activity of proteases and induces neuronal death. Z-Asp-Glu-Val-Asp-chloromethylketone has been shown to induce necrotic cell death in malignant brain cells and has neurotrophic properties. It also causes mitochondrial membrane depolarization, which leads to mitochondrial cytochrome c release and subsequent apoptosis. The reaction mechanism is still unclear but it may involve hydrogen bonding between the ketone group and the amide nitrogen atom of the aspartate residue.</p>Formula:C27H35ClN4O12Purity:Min. 95%Molecular weight:643.04 g/molSecretin (porcine) acetate salt
CAS:Controlled Product<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>Formula:C130H220N44O41Purity:Min. 95%Molecular weight:3,055.41 g/mol(Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate
CAS:Controlled Product<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>Formula:C66H86N18O12•(C2H4O2)xPurity:Min. 95%Molecular weight:1,323.5 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/mol2-Bromo-1-methyl-4-(methylsulfonyl)benzene
CAS:<p>Please enquire for more information about 2-Bromo-1-methyl-4-(methylsulfonyl)benzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H9BrO2SPurity:Min. 95%Molecular weight:249.13 g/molHIV-1 gag Protein p24 (194-210)
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (194-210) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H126N20O23SPurity:Min. 95%Molecular weight:1,683.97 g/molZ-Arg-Arg-bNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H39N9O4Purity:Min. 95%Molecular weight:589.69 g/molNeuromedin U-8 (porcine) trifluoroacetate salt
CAS:<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>Formula:C54H78N16O10Purity:Min. 95%Molecular weight:1,111.3 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molACTH (3-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (3-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H196N38O27SPurity:Min. 95%Molecular weight:2,683.19 g/molAc-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H43N10O12PPurity:Min. 95%Molecular weight:742.67 g/molPyr-Trp-OEt
CAS:<p>Please enquire for more information about Pyr-Trp-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H21N3O4Purity:Min. 95%Molecular weight:343.38 g/molHymenistatin I Cyclo(-Pro-Pro-Tyr-Val-Pro-Leu-Ile-Ile)
CAS:<p>Hymenistatin I is a cyclic peptide that is synthesized from the natural amino acid L-proline. It has been shown to inhibit tumor growth and is used in the treatment of bladder cancer. The synthesis of Hymenistatin I begins with the protection of proline as an N-tert-butyloxycarbonyl derivative, followed by a sequence of coupling reactions. This synthetic process involves the use of a linker, such as tetrazole or succinimidyl ester, for example. The final product can then be purified by HPLC analysis. Hymenistatin I inhibits calcineurin inhibitor, which are immunosuppressive agents that are used to treat lymphocytic leukemia and other autoimmune diseases.</p>Formula:C47H72N8O9Purity:Min. 95%Molecular weight:893.12 g/molFmoc-Lys(Boc)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/molBoc-L-β-homoleucine
CAS:<p>Please enquire for more information about Boc-L-beta-homoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H23NO4Purity:Min. 95%Molecular weight:245.32 g/molZ-β-Ala-Val-OH
CAS:<p>Please enquire for more information about Z-beta-Ala-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molH-Gly-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·C2H4O2Purity:Min. 95%Molecular weight:281.31 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molAmyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H107N19O17SPurity:Min. 95%Molecular weight:1,494.76 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molN-Hydroxy-2-phenyl-acetamide
CAS:<p>N-Hydroxy-2-phenyl-acetamide is a metalloprotease inhibitor that binds to the active site of the enzyme, thereby preventing it from binding with its natural substrate. This drug has been shown to inhibit the production of TNF-α in mice with autoimmune diseases and may be able to inhibit other proinflammatory mediators. N-Hydroxy-2-phenyl-acetamide has been shown to bind to a water molecule and an aliphatic hydrocarbon in order to form a hydrogen bond. This coordination complex inhibits the activity of matrix metalloproteinases, which are enzymes that break down collagen, elastin, and other proteins in the extracellular matrix. N-Hydroxy-2-phenyl-acetamide is not active against acid complexes or tnfα.</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:White Yellow PowderMolecular weight:151.16 g/mol(d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H78N13O10S2Purity:Min. 95%Molecular weight:1,121.4 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS:<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N13O11Purity:Min. 95%Molecular weight:1,156.33 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/molH-Pro-Leu-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H26N4O5Purity:Min. 95%Molecular weight:342.39 g/molpTH-Related Protein (1-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>Formula:C180H288N58O47Purity:Min. 95%Molecular weight:4,016.58 g/molAQEE-30 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H245N47O56Purity:Min. 95%Molecular weight:3,674.9 g/molEpinecidin-1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C114H176N30O21SPurity:Min. 95%Molecular weight:2,334.87 g/molH-Pro-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O5Purity:Min. 95%Molecular weight:447.53 g/mol(H-Cys-Tyr-OH)2
CAS:<p>Please enquire for more information about (H-Cys-Tyr-OH)2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30N4O8S2Purity:Min. 95%Color and Shape:PowderMolecular weight:566.65 g/mol4-Fluoro-2-methoxyaniline
CAS:<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/molH-Asp-Asp-Asp-OH
CAS:<p>H-Asp-Asp-Asp-OH is a peptide that has been shown to disrupt the cytosol and cause apoptosis. It can also induce proteolytic maturation and modulate autocatalytic functions. H-Asp-Asp-Asp-OH induces apoptosis by activating caspase 9 and caspase 3, which cleaves poly (ADP ribose) polymerase (PARP). This leads to DNA fragmentation, chromatin condensation, nuclear fragmentation, cell shrinkage, membrane blebbing, and nuclear pyknosis. H-Asp-Asp-Asp-OH binds to the regulatory domain of caspase 9 and prevents it from being activated. The peptide also activates caspase 8 by binding to its regulatory domain, which then activates caspases 3 and 7. H-Asp-Asp-Asp-OH also stimulates the release of granzyme B from cytot</p>Formula:C12H17N3O10Purity:Min. 95%Molecular weight:363.28 g/molFmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H38N2O7Purity:Min. 95%Color and Shape:White PowderMolecular weight:586.67 g/molH-D-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-D-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molAcetyl-Pepstatin Ac-Val-Val-Sta-Ala-Sta-OH
CAS:<p>Acetyl-Pepstatin is a protein data inhibitor that binds to the active site of enzymes, inhibiting their function. Acetyl-pepstatin has been shown to inhibit cathepsin D, chymotrypsin, and trypsin. It also inhibits the activity of proteases in the stomach and intestinal tract. Acetyl-Pepstatin is used as an anti-inflammatory drug for the treatment of chronic obstructive pulmonary disease (COPD) and congestive heart failure (CHF). The inhibition of these enzymes reduces inflammation by preventing the activation of inflammatory cytokines. It also prevents collagen from being degraded by proteases, which leads to decreased degradation of cartilage by chondrocytes. This drug's mechanism is similar to that of acetylsalicylic acid (aspirin), in that it inhibits prostaglandin synthesis.br></p>Formula:C31H57N5O9Purity:Min. 95%Molecular weight:643.81 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molBoc-Phe-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%FMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh
<p>Please enquire for more information about FMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Deamino-Cys1,b-(3-pyridyl)-D-Ala2,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.</p>Formula:C45H63N15O11S2Purity:Min. 95%Molecular weight:1,054.21 g/mol(Lys3)-Bombesin
CAS:<p>Lys3-Bombesin is a bifunctional peptide that binds to the bombesin receptor and is used in cancer therapy. It is a radiotracer, which can be used for diagnostic imaging and diagnosis of tumors. Lys3-Bombesin has a high affinity for the bombesin receptor subtype B, which is expressed by prostate cancer cells. The peptide can be conjugated to a small molecule, such as a radioactive isotope, and used to deliver it specifically to the tumor site. This compound has been shown to inhibit the growth of human prostate cancer cells in vitro.</p>Formula:C71H110N22O18SPurity:Min. 95%Molecular weight:1,591.84 g/molH-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molFmoc-Thr(PO3H2)-OH
CAS:<p>Please enquire for more information about Fmoc-Thr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H20NO8PPurity:Min. 95%Molecular weight:421.34 g/molPeptide 6A
CAS:<p>Peptide 6A is a cyclic peptide that has been shown to have analgesic and anti-inflammatory effects. It is synthesized by conjugating the amino acid alanine to the N-terminal of arginine, which leads to a polymer conjugate. The cyclic peptide has been shown to inhibit pain responses in anesthetized animals as well as inhibit blood pressure in rats with hypertension. In addition, it showed significant vasodilatory effects and inhibited sodium citrate induced platelet aggregation. Treatment with peptide 6A also decreases fibrinogen levels in humans and showed radical scavenging activities in human serum.</p>Formula:C23H43N9O6Purity:Min. 95%Molecular weight:541.64 g/molDnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H64N14O11Purity:Min. 95%Molecular weight:977.08 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H107N21O18Purity:Min. 95%Molecular weight:1,626.81 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molBoc-Pro-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Hydrin 2
CAS:<p>Hydrin 2 is a member of the family of peptide hormones that are involved in the regulation of blood pressure. It is synthesized from two amino acids, H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Arg-Gly-Gly-. Hydrin 2 has been shown to have biological properties that are similar to those of angiotensin II and vasopressin. This peptide hormone is produced as a result of the action of hydrochloric acid on the precursor peptide, which is synthesized in the ventral and apical regions of the bladder. The reaction product is soluble in water and has been shown to be effective at treating wastewater.</p>Formula:C45H69N15O14S2Purity:Min. 95%Molecular weight:1,108.25 g/molSyndyphalin SD-33
CAS:<p>Please enquire for more information about Syndyphalin SD-33 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H34N4O5SPurity:Min. 95%Molecular weight:502.63 g/molH-Leu-Trp-Met-Arg-Phe-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-OH acetate salt is a molecule that transports amino acids across the cell membrane of bacteria, preventing bacterial growth. It is produced by proctolin and functional groups in dental plaque. This compound has been shown to inhibit the growth of bacteria in vitro by binding to hypochlorous acid, which is part of the antimicrobial activity of human neutrophils. H-Leu-Trp-Met-Arg-Phe-OH acetate salt has been used as a tracer for studying amino acid transport in E. coli cells and its uptake into extracellular vesicles. The product can also be used as an antiplaque agent due to its ability to inhibit the acid transport system and uptake of amino acids from the environment.</p>Formula:C37H53N9O6SPurity:Min. 95%Molecular weight:751.94 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/molH-Tyr-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molZ-Phe-Arg-OMe·HCl
CAS:<p>Please enquire for more information about Z-Phe-Arg-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H31N5O5·HClPurity:Min. 95%Molecular weight:505.99 g/molN-(2-Carbamoyl-ethyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-(2-Carbamoyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H32N4O3Purity:Min. 95%Molecular weight:376.49 g/molBoc-L-tyrosine methyl ester
CAS:<p>Boc-L-tyrosine methyl ester is a synthetic amino acid that can be used in the production of peptides and proteins. It has been shown to have a high uptake and hydroxyl group, which allows for the synthesis of dopamine. The kinetic study of Boc-L-tyrosine methyl ester in agarose gels has shown that it has a high affinity for dopamine. Boc-L-tyrosine methyl ester has also been used as an intermediate for the synthesis of peptides and proteins. It is not active against cancer cells but has been used to induce matrix metalloproteinase (MMP) activity in Mcf-7 cells.</p>Formula:C15H21NO5Purity:Min. 95%Color and Shape:White PowderMolecular weight:295.33 g/molH-Gly-Arg-Gly-Glu-Thr-Pro-OH
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Thr-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H41N9O10Purity:Min. 95%Molecular weight:615.64 g/molZ-Glu-Gly-OH
CAS:<p>Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.</p>Formula:C15H18N2O7Purity:Min. 95%Molecular weight:338.31 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/molMca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H103N23O24Purity:Min. 95%Molecular weight:1,638.7 g/molGM-CSF (96-112)
CAS:<p>Please enquire for more information about GM-CSF (96-112) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H139N21O29SPurity:Min. 95%Molecular weight:1,987.24 g/mol1,2-Dilauroyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>Formula:C32H64NO8PPurity:Min. 95%Molecular weight:621.83 g/molBPP 9a Pyr-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro-OH
CAS:<p>BPP 9a is an enzyme inhibitor that binds to the active site of angiotensin-converting enzyme (ACE) and blocks its activity. It is a nonsteroidal anti-inflammatory drug that has been shown to be effective in reducing inflammation and pain associated with arthritis, osteoarthritis, gout, and menstrual cramps. BPP 9a has also been shown to reduce blood pressure in a dose-dependent manner, which may be due to its ability to inhibit the synthesis of angiotensin II from angiotensin I. This inhibition may lead to decreased vascular tone and blood pressure. BPP 9a has also been shown to have beneficial effects on bowel disease and polymerase chain reaction (PCR) analysis of DNA.</p>Formula:C53H76N14O12Purity:Min. 95%Molecular weight:1,101.26 g/molIndole-3-acetic-L-alanine
CAS:<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>Formula:C13H14N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:246.26 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molH-Trp-Pro-Tyr-OH
CAS:<p>The peptide H-Trp-Pro-Tyr-OH is a tripeptide with a dihedral angle of 180°. It has been studied by infrared and fluorescence spectroscopy, and the proton resonances have been assigned to H1, H2, and H3. The zwitterion form of this peptide is predicted to be more stable than the isomeric form due to its higher solvation energy. The peptide transporter in the intestinal tract has been shown to transport this peptide via an electrophilic mechanism.</p>Formula:C25H28N4O5Purity:Min. 95%Molecular weight:464.51 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N4O5Purity:Min. 95%Molecular weight:302.33 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H82N16O17SPurity:Min. 95%Molecular weight:1,403.52 g/molAc-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu-NH2
CAS:<p>The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.</p>Formula:C96H123N19O22Purity:Min. 95%Molecular weight:1,895.12 g/molAcetyl-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C186H284N50O61SPurity:Min. 95%Molecular weight:4,228.61 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H113N21O25Purity:Min. 95%Molecular weight:1,888.99 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/mol2-Bromo-6-methylpyridin-3-ol
CAS:<p>2-Bromo-6-methylpyridin-3-ol is a heterocyclic organic compound. It is a pyridine ring with two methyl groups attached to the ring at positions 2 and 6. The bromine atom is at position 3. This is an important intermediate in the Suzuki coupling reaction, which uses it as a starting material for the synthesis of many other compounds. The dieckmann condensation reaction produces this compound from 2,6-dichloropyridine and other reagents. Fluorescent when exposed to UV light, this compound has been used as a probe for chloride ions in solution using mass spectroscopy. This substance also yields dieckmann condensation products with alkynes and chlorine or bromine. 2-Bromo-6-methylpyridin-3-ol can be produced by treating pyridine with methylacrylate in the presence of catalysts such as copper(II)</p>Formula:C6H6BrNOPurity:Min. 95%Molecular weight:188.02 g/molH-Gln-Gly-Pro-OH·TFA
CAS:<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N4O5·C2HF3O2Purity:Min. 95%Molecular weight:414.33 g/molHIV (gp120) Fragment (308-331)
CAS:<p>HIV is a type of virus that causes AIDS. HIV infects the cells of the human immune system, destroying them and making the body vulnerable to infections from other types of viruses and bacteria. The gp120 protein is an envelope glycoprotein that mediates binding to the CD4 receptor on host T-helper cells and induces fusion of viral and cellular membranes. The gp120 protein has been studied using a variety of methods, including neutralizing antibody binding experiments, enzyme-linked immunosorbent assays (ELISA), Western blotting, peptide mapping, and density lipoprotein binding assays. This fragment contains residues 308-331 in a human immunodeficiency virus (HIV) type 1 gp120 protein.</p>Formula:C114H199N41O31Purity:Min. 95%Molecular weight:2,640.06 g/molH-Lys(isopropyl)-OH
CAS:<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H20N2O2Purity:Min. 95%Molecular weight:188.27 g/molCholecystokinin-33 (10-20) (bovine, porcine)
CAS:<p>Please enquire for more information about Cholecystokinin-33 (10-20) (bovine, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H90N16O18Purity:Min. 95%Molecular weight:1,251.39 g/molAc-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H139N27O29S2Purity:Min. 95%Molecular weight:2,211.44 g/molH-Val-Phe-OH
CAS:<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>Formula:C14H20N2O3Purity:Min. 95%Molecular weight:264.32 g/molNeuromedin U-23 (rat) trifluoroacetate salt
CAS:<p>Neuromedin U-23 (rat) is a peptide that belongs to the family of tachykinins, which are small neuropeptides that act as neurotransmitters in the central nervous system. It is a potent stimulator of intestinal motility and has been shown to have protective effects against oxidative stress in cells. Neuromedin U-23 (rat) shares sequence similarity with human neuromedin N-19 and binds to the same receptors in the brain, suggesting it may have similar physiological effects. This peptide has been shown to inhibit tumor cell growth by inducing apoptosis, but it does not appear to have any effect on healthy cells.</p>Formula:C124H180N34O31Purity:Min. 95%Molecular weight:2,642.97 g/mol(S)-(-)-3-Chloro-1-phenyl-1-propanol
CAS:<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>Formula:C9H11ClOPurity:Min. 95%Molecular weight:170.64 g/molAmyloid β-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H285N51O54SPurity:Min. 95%Molecular weight:4,143.64 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/mol2-Chloromethyl-4-(3-methoxypropoxy)-3-methylpyridine hydrochloride
CAS:<p>Please enquire for more information about 2-Chloromethyl-4-(3-methoxypropoxy)-3-methylpyridine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H17Cl2NO2Purity:Min. 95%Molecular weight:266.16 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/molFmoc-Ile-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/molH-Ala-Phe-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Phe-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H20N4O4·HClPurity:Min. 95%Molecular weight:392.84 g/molH-Gly-Tyr-NH2·HCl
CAS:<p>H-Gly-Tyr-NH2·HCl is a peptide that has been shown to have an inhibitory effect on 5-hydroxytryptamine (5-HT) receptors. It can be used as a diluent for pharmaceuticals and as a potential treatment for autoimmune diseases, which are caused by the immune system attacking healthy cells. H-Gly-Tyr-NH2·HCl has also been shown to have antiestrogenic effects in breast cancer cells. This compound may be useful for treating inflammation associated with infectious diseases, such as Stenotrophomonas maltophilia, and other inflammatory diseases, such as inflammatory bowel disease. The amide group in this peptide may also be important for its antimicrobial properties against gram negative bacteria, such as Escherichia coli.</p>Formula:C11H15N3O3·HClPurity:Min. 95%Molecular weight:273.72 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/molBoc-guanidine
CAS:<p>Guanidine is a guanidinium cation that is used in the treatment of autoimmune diseases, cancer, and aspartyl receptor activity. Boc-guanidine is an efficient method for the synthesis of guanidine. It has been shown to be effective in treating inflammatory diseases and neutral pH conditions. Boc-guanidine inhibits glycogen synthase kinase-3 (GSK3) and membrane interactions, which are associated with a number of human disorders. It also has antimicrobial properties against marine microorganisms.</p>Formula:C6H13N3O2Purity:Min. 95%Molecular weight:159.19 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/molH-Met-Thr-OH
CAS:<p>Met-Thr-OH is a peptide binding inhibitor that is used as a research tool for determining the role of metalloproteins in vivo. Methionine aminopeptidase (MetAP) is an enzyme that cleaves methionine from protein and peptides and has been shown to play a vital role in cancer progression. MetAP has been shown to be inhibited by Met-Thr-OH, which binds to the enzyme's active site and blocks its activity. The inhibition of MetAP limits the production of proteins involved in cell growth and proliferation, leading to reductions in tumor size. This inhibition may also be due to the inhibition of other functional groups such as phosphorylation, dephosphorylation, or nitrosylation.</p>Formula:C9H18N2O4SPurity:Min. 95%Molecular weight:250.32 g/molAntistasin-Related Peptide
CAS:<p>Please enquire for more information about Antistasin-Related Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H57N15O8S2Purity:Min. 95%Molecular weight:868.04 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molToxic Shock Syndrome Toxin-1 (TSST-1) (58-78)
CAS:<p>Please enquire for more information about Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H171N33O35Purity:Min. 95%Molecular weight:2,371.61 g/molZ-Phe-Leu-OH
CAS:<p>Z-Phe-Leu-OH is a protease inhibitor that belongs to the group of peptidyl-protease inhibitors. It inhibits the activity of a wide range of proteases and is specifically active against carboxypeptidases A and B. Z-Phe-Leu-OH has been shown to be specific for these enzymes, with no inhibitory activity against other proteases such as aminopeptidases, serine proteases, or metalloproteases. The amino acid composition of this protease inhibitor is different from other inhibitors that have been studied in detail. This agent was found to be more effective than phenylmethylsulfonyl fluoride (PMSF) at inhibiting carboxypeptidase A and B.<br>Z-Phe-Leu-OH has been shown to be an acidic compound with a pKa of 5.5; however, it does not react with chloromethyl ketone</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molAc-tBu-Gly-tBu-Gly-Asn(Me)2-Ala-AMC
CAS:<p>Please enquire for more information about Ac-tBu-Gly-tBu-Gly-Asn(Me)2-Ala-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H50N6O8Purity:Min. 95%Molecular weight:658.79 g/molProadrenomedullin (1-20) (human)
CAS:<p>Proadrenomedullin (1-20) is a polypeptide that is found in human plasma. It is a member of the vasoactive intestinal peptide family and has been shown to be involved in the regulation of vascular tone, blood pressure, and blood vessel permeability. Proadrenomedullin (1-20) also inhibits the production of proinflammatory cytokines such as tumor necrosis factor-alpha, interleukin-6, and interleukin-8. This compound has been shown to have antiviral activity against HIV and herpes simplex virus type 1. Proadrenomedullin (1-20) also functions as a growth factor for tumor cells.</p>Formula:C112H178N36O27Purity:Min. 95%Molecular weight:2,460.84 g/molBoc-L-valine
CAS:<p>Boc-L-Valine is a model system for the synthesis of peptides. This compound is synthesized in a liquid phase and then purified by column chromatography. It has an antimicrobial activity against Gram-positive bacteria such as Staphylococcus aureus and Escherichia coli, but not against Gram-negative bacteria such as Proteus vulgaris or Pseudomonas aeruginosa. Boc-L-Valine is also used to study the binding of inhibitors and ferrocenes.</p>Formula:C10H19NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:217.3 g/molFmoc-Cit-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cit-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Aloc-OSu
CAS:<p>Aloc-OSu is a glycosylated glycopeptide antibiotic that belongs to the class of degradable antibiotics. The drug binds to the enzyme UDP-N-acetylglucosamine:glycoprotein glucosyltransferase, thereby inhibiting bacterial cell wall synthesis. Aloc-OSu has been shown to be effective against methicillin resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. Aloc-OSu has shown anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis.</p>Formula:C8H9NO5Purity:Min. 95%Molecular weight:199.16 g/molZ-Gly-Ala-Pro-bNA
CAS:<p>Z-Gly-Ala-Pro-bNA is a peptidase that hydrolyzes peptides. The peptidase has two catalytic domains, which are located at the N and C termini of the protein. The N-terminal domain contains an oligopeptidase motif that has been shown to be important for the hydrolysis of substrates with hydrophobic residues. The C-terminal domain contains a cavity, which is necessary for binding to substrate and catalysis. This catalytic domain also contains an acid substitution, which may contribute to its stability in acidic environments. A mutant form of Z-Gly-Ala-Pro-bNA was generated by changing the amino acid residue at position n from serine to asparagine, which led to an increase in thermostability and in catalytic activity.</p>Formula:C28H30N4O5Purity:Min. 95%Molecular weight:502.56 g/molZ-Tyr-Phe-OH
CAS:<p>Please enquire for more information about Z-Tyr-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H26N2O6Purity:Min. 95%Molecular weight:462.49 g/molH-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH
CAS:<p>Please enquire for more information about H-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H91N17O15Purity:Min. 95%Molecular weight:1,254.44 g/molH-Glu-Tyr-OH
CAS:<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>Formula:C14H18N2O6Purity:Min. 95%Molecular weight:310.3 g/molZ-Pro-Leu-OH
CAS:<p>The compound Z-Pro-Leu-OH is a peptidomimetic that has been shown to be an effective inhibitor of the enzyme l-amino acid oxidase, which catalyzes the oxidation of l-amino acids. This inhibition may be due to the protonation of the substrate and/or solvents in the enzyme active site. The molecule is hydrophobic, making it suitable for use in simulations and theoretical studies. Furthermore, this compound is identifiable by its retention time on high performance liquid chromatography (HPLC) and can be rationalized by its amide group.</p>Formula:C19H26N2O5Purity:Min. 95%Molecular weight:362.42 g/mol(D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H99N19O15Purity:Min. 95%Molecular weight:1,338.56 g/molZ-Ile-His-OH
CAS:<p>Please enquire for more information about Z-Ile-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N4O5Purity:Min. 95%Molecular weight:402.44 g/mol5-FAM-Woodtide trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H133N21O26SPurity:Min. 95%Molecular weight:1,945.2 g/molH-Gly-Met-Gly-OH
CAS:<p>H-Gly-Met-Gly-OH is an amide containing a sulfoxide group. It is synthesized from the amino acid glycine and the tripeptide Met-Gly-Gly. The synthesis of HMG was first reported by Sato in 1907, although it was not used as a drug until 1983. This drug has potential antitumor activity and inhibits the growth of certain tumor cells. HMG is metabolized by peptidases, which hydrolyze the peptide bond between glycine and Met-Gly-Gly. Hydrolysis of HMG yields glyoxylic acid (H2O2) and the amino acids glycine and methanol. HMG also inhibits the uptake of glucose into cells, which may be related to its antitumor effect. X-ray diffraction studies have shown that HMG has a carboxylate group at C6 that binds to three oxygen atoms, which are present in two</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molN-Benzoyl-N-phenylhydroxylamine
CAS:<p>N-Benzoyl-N-phenylhydroxylamine is a compound that has been shown to be an optimum concentration for the production of molybdenum. It is a model system for the extraction and separation of molybdenum from other metals. The extraction process involves acidification with nitric acid, followed by precipitation with sodium benzoate. N-Benzoyl-N-phenylhydroxylamine is extracted using an electrode and then purified with a metal chelate. This compound has been shown to have synergistic effects when combined with vanadium, which may be due to their similar chemical properties.</p>Formula:C13H11NO2Purity:Min. 95%Molecular weight:213.23 g/molZ-Val-Ala-OMe
CAS:<p>Z-Val-Ala-OMe is an anti-leishmanial agent that has been shown to be a more efficient method for the treatment of leishmaniasis than current treatments. It inhibits the growth of Leishmania by inhibiting serine proteases, which are involved in the formation of amorphous material on the surface of these parasites. Z-Val-Ala-OMe is active against both subtilis and licheniformis, with a residue half life of 3 hours at pH 5.5 and 20 degrees Celsius. This drug binds to the surface of Leishmania parasites and inhibits their ability to metabolize phosphite into ethyl esters.<br>The kinetic data obtained from Z-Val-Ala-OMe was measured using immobilized cells in a microtiter plate assay system. The data collected was used to generate a graph showing an initial burst phase followed by a linear phase for up to 72 hours post incubation with the drug</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H268N48O51S2Purity:Min. 95%Molecular weight:4,044.53 g/molN-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt
CAS:<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>Formula:C32H36N4O7Purity:Min. 95%Molecular weight:588.65 g/molFmoc-Tyr(SO3H)-OH barium salt
CAS:<p>Please enquire for more information about Fmoc-Tyr(SO3H)-OH barium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H21NO8SPurity:Min. 95%Molecular weight:483.49 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/molH-Pro-Tyr-NH2·HCl
CAS:<p>Noopept is a peptide-like nootropic drug that belongs to the group of analogs of proline. It has been shown to have neuroprotective and cognitive enhancing effects in animal studies, as well as an antipsychotic effect. Noopept is a competitive antagonist of the glutamate receptor, and also has affinity for dopamine and serotonin receptors. Noopept is taken orally and penetrates into the brain quickly, where it interacts with different types of neurotransmitter systems. It also shows translational activity in vitro (in cell culture) and in vivo (in animals). This substance can be detected in human blood plasma following oral administration.</p>Formula:C14H19N3O3·HClPurity:Min. 95%Molecular weight:313.78 g/molH-Leu-Arg-Pro-OH
CAS:<p>Please enquire for more information about H-Leu-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H32N6O4Purity:Min. 95%Molecular weight:384.47 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molBoc-Cys(SEt)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-Cys(SEt)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO4S2·C12H23NPurity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:462.71Cholecystokinin Octapeptide (1-3) (desulfated)
CAS:<p>Cholecystokinin Octapeptide (1-3) (desulfated) is a research chemical that has various applications in the field of chemistry and biology. This compound contains a hydrogen atom that plays a crucial role in solvation processes. It can be used in supercritical reactions due to its ability to interact with hydroxyl groups on metallic surfaces like silicon substrates. Additionally, Cholecystokinin Octapeptide (1-3) (desulfated) is utilized in thiol-ene reactions and chromatographic separations.</p>Formula:C18H25N3O7SPurity:Min. 95%Molecular weight:427.47 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H179N35O28SPurity:Min. 95%Molecular weight:2,591.99 g/molSarafotoxin C trifluoroacetate salt
CAS:<p>Sarafotoxin C is a peptide from the venom of the spider Phoneutria nigriventer that has been shown to have potent inhibitory properties on endothelin-1. Sarafotoxin C is able to block intracellular Ca2+ levels and signal pathways, leading to decreased levels of endothelin-1 as well as other inflammatory mediators. Sarafotoxin C has also been shown to have an anti-inflammatory effect in bowel disease, which may be due to its ability to inhibit the production of cytokines and prostaglandins. The biological properties of sarafotoxin C are related to its inhibition of polymerase chain reaction (PCR) amplification of DNA. This inhibition is due to the binding of sarafotoxin C with endothelin receptors on DNA, which prevents DNA polymerase from attaching. Endothelin-a receptor activity can also be inhibited by sarafotoxin C through enzymatic inactivation. Sarafot</p>Formula:C103H147N27O37S5Purity:Min. 95%Molecular weight:2,515.76 g/molH-Val-Ser-OH
CAS:<p>L-Threonine is an amino acid that belongs to the branched-chain family of amino acids. It is a nonessential amino acid, meaning that it can be synthesized by the human body. L-Threonine is one of the two amino acids (along with L-Serine) that has a hydroxyl group on the alpha carbon atom. It is also used in certain metabolic pathways such as sphingolipid metabolism and tryptophan metabolism. L-Threonine is used in experimental models for bowel disease and intestinal cancer, but its role in these conditions has not been determined. The molecule can be found in both animal and plant proteins, but most often it occurs in animal sources. The compound can also be found as a component of skin condition treatments or as an additive to shampoos, lotions, and cosmetics.</p>Formula:C8H16N2O4Purity:Min. 95%Molecular weight:204.22 g/molZ-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Z-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H34N6O6·HClPurity:Min. 95%Molecular weight:599.08 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molH-Glu-Glu-Asp-OH
CAS:<p>H-Glu-Glu-Asp-OH is a tripeptide that is a marker for endothelial cell proliferation. This peptide sequence has been shown to promote endothelial cell function, as well as to have atherogenic properties. The hydrolysate of H-Glu-Glu-Asp-OH has been shown to inhibit the growth of endothelial cells and functions in vitro.END><br>END></p>Formula:C14H21N3O10Purity:Min. 95%Molecular weight:391.33 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/mol(R)-4-N-Boc-2-hydroxymethyl-piperazine
CAS:<p>Please enquire for more information about (R)-4-N-Boc-2-hydroxymethyl-piperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3Purity:Min. 95%Molecular weight:216.28 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/molH-Ala-Thr-OH
CAS:<p>H-Ala-Thr-OH is a dipeptide that is used as a stabilizer for the active form of methionine in some nutritional supplements. H-Ala-Thr-OH is synthesized by the hydroxylation of DL-methionine, which is then converted to H-Ala-Thr-OH by an aminopeptidase. The amino acid sequence of H-Ala-Thr-OH resembles that of l-threonine, but lacks an α carbon atom and an amino group on the carboxylic acid end. This dipeptide has been shown to be auxotrophic for both lysine and threonine when expressed in Escherichia coli.</p>Formula:C7H14N2O4Purity:Min. 95%Molecular weight:190.2 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molMyristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H105N17O12Purity:Min. 95%Molecular weight:1,256.58 g/molFmoc-Dap(Adpoc)-OH
CAS:<p>Please enquire for more information about Fmoc-Dap(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N2O6Purity:Min. 95%Molecular weight:546.65 g/mol(D-Arg0, Hyp 3,D-Phe7,Leu8)-Bradykinin
CAS:<p>Please enquire for more information about (D-Arg0, Hyp 3,D-Phe7,Leu8)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H89N19O13Purity:Min. 95%Molecular weight:1,248.44 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH is a peptide that has been shown to have chemotactic activity for monocytes and polymorphonuclear leucocytes, which are cells that participate in the inflammatory response. It also has biological properties that are reactive with hydroxyl groups and can be used to generate monoclonal antibodies. H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH has been shown to stimulate the migration of galleria mellonella larvae, suggesting it may have potential as an antiinflammatory agent.</p>Formula:C28H49N11O11Purity:Min. 95%Molecular weight:715.76 g/molLHRH (7-10)·2 HCl
CAS:<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H36N8O4·2HClPurity:Min. 95%Molecular weight:513.46 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/molAcetyl-(D-Val13)-α-MSH (11-13)
CAS:<p>Please enquire for more information about Acetyl-(D-Val13)-alpha-MSH (11-13) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H33N5O4Purity:Min. 95%Molecular weight:383.49 g/molH-Ala-Ala-Pro-Leu-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Pro-Leu-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H34N6O6·HClPurity:Min. 95%Molecular weight:527.01 g/molZ-His(Bzl)-OH
CAS:<p>Please enquire for more information about Z-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21N3O4Purity:Min. 95%Molecular weight:379.41 g/molH-Cys(Bzl)-Gly-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O3S•(CF3CO2H)xPurity:Min. 95%Molecular weight:268.33 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Formula:C32H50N4O8Purity:Min. 95%Molecular weight:618.76 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/molHCV NS4A Protein (22-34) (H strain)
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-34) (H strain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H109N17O15SPurity:Min. 95%Molecular weight:1,328.67 g/molAmylin (human) trifluoroacetate salt
CAS:<p>Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.</p>Formula:C165H261N51O55S2Purity:Min. 95%Molecular weight:3,903.28 g/molFmoc-Gly-Pro-Hyp-OH
CAS:<p>Fmoc-Gly-Pro-Hyp-OH is a synthetic single-stranded amide with a stepwise hydrogen bond. The synthesis of this compound starts with the creation of an ester by reacting an acid and alcohol in the presence of catalysts. The ester is then reacted with a primary amine to form an amide, which can be hydrolyzed to release the desired product. This synthetic process has been used for the production of collagen and cyclic peptides. Fmoc-Gly-Pro-Hyp-OH has been modified to include modifications such as alkene and modifications such as strategies, synthons, and isosteres.</p>Formula:C27H29N3O7Purity:Min. 95%Molecular weight:507.54 g/molH-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH
CAS:<p>Please enquire for more information about H-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N11O21PPurity:Min. 95%Molecular weight:1,118.05 g/molOctreotide trifluoroacetate salt (Dimer, Antiparallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Antiparallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/mol1-O-Octadecyl-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-Octadecyl-2-O-acetyl-sn-glycero-3-phosphocholine (OGPC) is a phospholipid that has been shown to be an effective drug in the treatment of chronic arthritis. It is a potent antagonist of the inflammatory response, and has been shown to inhibit the production of inflammatory cytokines such as tumour necrosis factor alpha (TNFα). OGPC has been used in cell culture studies, which have shown that it inhibits IL2 receptor binding and TNFα release by human monocytes. Clinical studies have also shown that OGPC can be used to treat arthritis.</p>Formula:C28H58NO7PPurity:Min. 95%Molecular weight:551.74 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/mol
