Amino Acids (AA)

<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>

<p>Please enquire for more information about MeOSuc-Lys(2-picolinoyl)-Ala-Pro-Val-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Trp6,Pro-NHEt 9)-LHRH (sea bream) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sapecin is an antimicrobial peptide, which is derived from the hemolymph of the silk moth (Bombyx mori) with potent bactericidal action. The source of Sapecin is the immune system of the silk moth, where it acts as a natural defense mechanism against microbial infections. Its mode of action involves disrupting bacterial cell membranes, leading to cell lysis and death. The peptide achieves this by inserting itself into the lipid bilayer, creating pores that compromise the structural integrity of the membrane.</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bz-DL-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Chloro-3-methoxybenzaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is a potent activin antagonist that has been shown to inhibit follicle development in ovary cells. It also blocks the protease activity of leishmania, which is a parasite that causes cutaneous leishmaniasis. This drug binds to proteases and inhibits their activity by competing with substrates for the active site. Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is not expressed in the submandibular gland or the submaxillary gland, which are salivary glands.</p>

<p>Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le</p>

<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>

<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>

<p>Please enquire for more information about Z-N-Me-D-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>H-Pro-His-Phe-OH is a proteolytic enzyme that belongs to the group of serine proteases. It is a member of the subtilisin family and has been used in research for its ability to cleave proteins at random. H-Pro-His-Phe-OH has been shown to hydrolyze lactococcal proteinase and other serine proteases, such as trypsin, chymotrypsin, and elastase.</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Please enquire for more information about H-Arg-Ala-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-beta-Chloro-Ala-NHOH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Tyr-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>F-Ala-Arg-OH is a peptide hormone that has been shown to have antitumor, antiinflammatory, and antidiabetic properties. The peptide hormone binds to the creatine kinase enzyme and inhibits its activity, which leads to a decrease in phosphocreatine levels in the human serum. F-Ala-Arg-OH does not inhibit lysine residues of the creatine kinase enzyme. This inhibition can be reversed by adding ATP or adding an activator. F-Ala-Arg-OH also inhibits cancer cells through apoptosis. This inhibition of cancer cells may be due to the ability of this peptide to bind to lysine residues on cell membranes and activate them. F-Ala-Arg-OH is also able to destroy tumor cells by binding to their mitochondria and inducing their lysis.</p>

<p>Aloc-Ser-OMe is an enzyme that catalyzes the cleavage of 1,4-linked alpha-D-galactosides. It has been shown to be a useful reagent for the synthesis of alkyl glycosides. Aloc-Ser-OMe can be used in enzymatic synthesis or chemoenzymatic synthesis. This enzyme has excellent stereospecificity and is quantitatively active at pH 4.5 to 5.0 and at temperatures ranging from 20°C to 40°C. The enzyme can also catalyze transglycosylation reactions with beta-glucosidase, producing galactoarabinan oligosaccharides with various degrees of polymerization.</p>

<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>

<p>Please enquire for more information about Fmoc-D-proline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-[15N]Leu-OH is a research chemical that has various applications in the field of biosynthesis and antibody production. It is commonly used in peptide synthesis and as a building block for the preparation of peptides and proteins. Fmoc-[15N]Leu-OH is known for its high purity and quality, making it an ideal choice for researchers and scientists working in the field of molecular biology. This compound can be easily dissolved in ethanol or other organic solvents, allowing for convenient use in laboratory experiments. With its unique characteristics and wide range of applications, Fmoc-[15N]Leu-OH is a valuable tool for those involved in biochemical research.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>

<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Asp-Glu-Val-Asp-chloromethylketone is a reactive compound that inhibits the activity of proteases and induces neuronal death. Z-Asp-Glu-Val-Asp-chloromethylketone has been shown to induce necrotic cell death in malignant brain cells and has neurotrophic properties. It also causes mitochondrial membrane depolarization, which leads to mitochondrial cytochrome c release and subsequent apoptosis. The reaction mechanism is still unclear but it may involve hydrogen bonding between the ketone group and the amide nitrogen atom of the aspartate residue.</p>

<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>

<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Please enquire for more information about 2-Bromo-1-methyl-4-(methylsulfonyl)benzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 gag Protein p24 (194-210) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about ACTH (3-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Trp-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hymenistatin I is a cyclic peptide that is synthesized from the natural amino acid L-proline. It has been shown to inhibit tumor growth and is used in the treatment of bladder cancer. The synthesis of Hymenistatin I begins with the protection of proline as an N-tert-butyloxycarbonyl derivative, followed by a sequence of coupling reactions. This synthetic process involves the use of a linker, such as tetrazole or succinimidyl ester, for example. The final product can then be purified by HPLC analysis. Hymenistatin I inhibits calcineurin inhibitor, which are immunosuppressive agents that are used to treat lymphocytic leukemia and other autoimmune diseases.</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-L-beta-homoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-beta-Ala-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Hydroxy-2-phenyl-acetamide is a metalloprotease inhibitor that binds to the active site of the enzyme, thereby preventing it from binding with its natural substrate. This drug has been shown to inhibit the production of TNF-α in mice with autoimmune diseases and may be able to inhibit other proinflammatory mediators. N-Hydroxy-2-phenyl-acetamide has been shown to bind to a water molecule and an aliphatic hydrocarbon in order to form a hydrogen bond. This coordination complex inhibits the activity of matrix metalloproteinases, which are enzymes that break down collagen, elastin, and other proteins in the extracellular matrix. N-Hydroxy-2-phenyl-acetamide is not active against acid complexes or tnfα.</p>

<p>Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>

<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Cys-Tyr-OH)2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>

<p>H-Asp-Asp-Asp-OH is a peptide that has been shown to disrupt the cytosol and cause apoptosis. It can also induce proteolytic maturation and modulate autocatalytic functions. H-Asp-Asp-Asp-OH induces apoptosis by activating caspase 9 and caspase 3, which cleaves poly (ADP ribose) polymerase (PARP). This leads to DNA fragmentation, chromatin condensation, nuclear fragmentation, cell shrinkage, membrane blebbing, and nuclear pyknosis. H-Asp-Asp-Asp-OH binds to the regulatory domain of caspase 9 and prevents it from being activated. The peptide also activates caspase 8 by binding to its regulatory domain, which then activates caspases 3 and 7. H-Asp-Asp-Asp-OH also stimulates the release of granzyme B from cytot</p>

<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-Pepstatin is a protein data inhibitor that binds to the active site of enzymes, inhibiting their function. Acetyl-pepstatin has been shown to inhibit cathepsin D, chymotrypsin, and trypsin. It also inhibits the activity of proteases in the stomach and intestinal tract. Acetyl-Pepstatin is used as an anti-inflammatory drug for the treatment of chronic obstructive pulmonary disease (COPD) and congestive heart failure (CHF). The inhibition of these enzymes reduces inflammation by preventing the activation of inflammatory cytokines. It also prevents collagen from being degraded by proteases, which leads to decreased degradation of cartilage by chondrocytes. This drug's mechanism is similar to that of acetylsalicylic acid (aspirin), in that it inhibits prostaglandin synthesis.br&gt;</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.</p>

<p>Lys3-Bombesin is a bifunctional peptide that binds to the bombesin receptor and is used in cancer therapy. It is a radiotracer, which can be used for diagnostic imaging and diagnosis of tumors. Lys3-Bombesin has a high affinity for the bombesin receptor subtype B, which is expressed by prostate cancer cells. The peptide can be conjugated to a small molecule, such as a radioactive isotope, and used to deliver it specifically to the tumor site. This compound has been shown to inhibit the growth of human prostate cancer cells in vitro.</p>

<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Thr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide 6A is a cyclic peptide that has been shown to have analgesic and anti-inflammatory effects. It is synthesized by conjugating the amino acid alanine to the N-terminal of arginine, which leads to a polymer conjugate. The cyclic peptide has been shown to inhibit pain responses in anesthetized animals as well as inhibit blood pressure in rats with hypertension. In addition, it showed significant vasodilatory effects and inhibited sodium citrate induced platelet aggregation. Treatment with peptide 6A also decreases fibrinogen levels in humans and showed radical scavenging activities in human serum.</p>

<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>

<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hydrin 2 is a member of the family of peptide hormones that are involved in the regulation of blood pressure. It is synthesized from two amino acids, H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Arg-Gly-Gly-. Hydrin 2 has been shown to have biological properties that are similar to those of angiotensin II and vasopressin. This peptide hormone is produced as a result of the action of hydrochloric acid on the precursor peptide, which is synthesized in the ventral and apical regions of the bladder. The reaction product is soluble in water and has been shown to be effective at treating wastewater.</p>