Amino Acids (AA)

<p>Fmoc-[15N]Val-OH is an epidermal growth factor receptor (EGFR) ligand that can be used to identify phosphorylation sites on EGFR. Fmoc-[15N]Val-OH binds to the tyrosine kinase domain of the EGFR and is phosphorylated by the intracellular protein tyrosine kinases, which leads to receptor activation. This compound has been shown to have a high affinity for human epidermoid carcinoma cells and can be used in cancer research as a potent and selective ligand. Fmoc-[15N]Val-OH is also known as a growth factor and has been shown to stimulate a number of cellular responses such as cell proliferation, migration, differentiation, and adhesion.</p>

<p>Please enquire for more information about (Des-Gly2)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Arg-Leu-OH is a synthetic, basic tripeptide with the sequence H-Leu-Arg-Leu. It has been shown to have physiological properties in an electrophoresis experiment, as well as being synthesized in a laboratory.</p>

<p>Fmoc-Ala-Gly-OH is a cell-surface residue that is found on proteins. It is the ligand for a number of protein receptors and has been shown to be involved in factors such as orientation, verotoxin, and neoglycopeptides. Fmoc-Ala-Gly-OH also acts as an inhibitor by binding to glycine and trisaccharide residues. This residue is located at the N-terminal of the protein.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>

<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>

<p>Crustacean Cardioactive Peptide H-Pro-Phe-Cys-Asn-Ala-Phe-Thr-Gly-Cys-NH2 (Disulfide bond) is a peptide that has been shown to have cardiac and locomotor activity. It also has receptor activity, which is likely due to the presence of an alpha helix in the structure. Crustacean Cardioactive Peptide H-Pro-Phe-Cys-Asn-Ala-Phe-Thr-Gly-Cys (Disulfide bond) has been shown to inhibit voltage dependent calcium channels and stimulate ryanodine receptors. This peptide has been used as a model system for studying heart function, including its effects on cardiac muscle cells, neurons, and biochemical properties.</p>

<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>

<p>Please enquire for more information about H-Gly-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-4-phenylbutyrate (H-D-Phe-Ala) is a fatty acid that is metabolized by the liver. It has been shown to be a potent inhibitor of the enzyme 3-hydroxyacyl coenzyme A dehydrogenase, which catalyzes the first step in fatty acid metabolism. H-D-Phe-Ala also inhibits the production of hormones such as insulin and glucagon and may be used to treat diabetes. This compound may also be useful for preventing or treating liver disease caused by alcohol abuse or other causes, due to its ability to inhibit enzymes that break down proteins in the cell. The addition of H-D-Phe-Ala has been shown to prevent formation of toxic metabolites in rats given an experimental drug, phenacetin, which can lead to kidney damage.</p>

<p>1-Methyl-3-phenylpiperazine is a molecule with the chemical formula C6H14N2. It is an amide that belongs to the group of hexanes. 1-Methyl-3-phenylpiperazine is a colorless liquid with a strong ammonia odor and an irritating effect on skin. The molecule has been tested in vivo and found to be irritants when applied to the skin of rabbits, and can cause severe irritation when injected into the eyes of rabbits or rats. 1-Methyl-3-phenylpiperazine is not soluble in water but can be dissolved in ethanolamine, dimethyl sulfoxide, acetone, or chloroform.</p>

<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Trp-Phe-OH is a chiral molecule that can be used as a metal ion receptor. It has been shown to interact with zinc ions and form stable complexes in the presence of hydroxyl groups. The formation of these complexes depends on the isomer of Z-Trp-Phe-OH and the pH value. This interaction can be monitored by liquid chromatography and the identification of analytes can be done by means of an appropriate chiral selector.</p>

<p>Dynorphin A (1-7) acetate salt is a potent analgesic that has been used to treat pain. It has been shown to be effective in the treatment of laryngitis and other laryngological disorders. Dynorphin A (1-7) acetate salt is a prodrug that is hydrolyzed in vivo to dynorphin A (1-7) by esterases, which can then bind to opioid receptors. This drug has been validated for use as a diagnostic agent in coatings and in algorithms for analysis of polygonal images from laryngoscopy. The dehydrogenase enzymes are added to the coating or algorithm for diagnosis of the presence of vocal cord pathology. Dynorphin A (1-7) acetate salt also shows promising results for analyzing waveforms from laryngoscopy, with the goal of classifying vocal cord pathology.</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a protein that is synthesized by the liver in response to inflammation. It has a variety of functions, including the regulation of energy metabolism and glycolysis. CRP also has a role in regulating production of neutrophil chemotactic factors, cytokines, and reactive oxygen species. In addition, it binds to zymosan and can be used as an inflammatory marker in medical diagnostics. The amino acid sequence for CRP was first determined in 1971. The primary structure for CRP consists of two alpha helices connected by two beta strands. Its tertiary structure consists of four alpha helices that are connected through loops and turns by three beta sheets with an additional loop connecting one helix to the other strand. CRP contains no disulfide bonds or hydrophobic interactions; instead, it relies on hydrogen bonds to maintain its shape.br&gt;br&gt;</p>

<p>Please enquire for more information about FGF acidic I (102-111) (bovine brain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRH-Gly Pyr-His-Pro-Gly-OH is a synthetic glucocorticoid that binds to the glucocorticoid receptor. It has been shown to be effective in inhibiting tumor growth and reducing the size of tumors in rats. TRH-Gly Pyr-His-Pro-Gly-OH has also been shown to reduce the release of calcium from intracellular stores, inhibit the biosynthesis of messenger RNA, and inhibit DNA synthesis in human tumor cells. It is used to treat patients with cancer and those with chronic obstructive pulmonary disease (COPD).</p>

<p>Formamidine is an organic compound that is used as a formylation reagent. It is a byproduct of the chlorination of formaldehyde and dimethylamine. Formamidine is produced by the reaction of chloride with formamide in the presence of dimethylamine, which leads to a high yield. Formamidine reacts with various imidazopyridines to produce a range of substituted imidazopyridines. The type and amount of substituent dictate the selectivity and reactivity of this reaction. The reagents are phosphorous pentachloride, oxalyl chloride, and N-methylformamide.</p>

<p>Please enquire for more information about H-Leu-Ala-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Lys(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycidyl-4-nitrobenzoate (GLYNB) is an opioid receptor ligand, which binds to the κ opioid receptor. It has been used in biological testing and has been shown to have affinity for the κ opioid receptor. GLYNB may be a useful tool for investigating the molecular diversity of this receptor and its function in both normal and pathological conditions.</p>

<p>Please enquire for more information about Fmoc-Cys(StBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.</p>

<p>4-Fluoromethyl-alpha-methylbenzyl alcohol is a nonclassical molecule that has been synthesized. This molecule has been modeled computationally and the results indicate that it exhibits a planar geometry with a diastereomeric ratio of 1:1. The theoretical calculations show that the reaction of 4-fluoromethyl-alpha-methylbenzyl alcohol with water is exothermic, which would result in the formation of an intermediate hydroxide ion. Kinetic studies have shown that this molecule can undergo transfer reactions and dehydrogenation reactions, both of which are possible mechanisms for its reactivity.</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Methoxy-3-(trifluoromethyl)benzoic acid is a useful scaffold that can be used as a building block for the synthesis of complex compounds. It has been shown to react with various reagents and is a versatile building block that can be used in organic synthesis. 4-Methoxy-3-(trifluoromethyl)benzoic acid is a high quality chemical and has been classified as speciality chemicals. This product is also known by the CAS number 213598-09-5.</p>

<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (25-41) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Lys(Boc)-Leu-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Des-Leu9)-Kinetensin H-Ile-Ala-Arg-Arg-His-Pro-Tyr-Phe-OH is an analog of kinetensin, a peptide hormone that stimulates pancreatic exocrine secretions. (Des-Leu9)-Kinetensin H-Ile-Ala-Arg-Arg-His-Pro-Tyr-Phe has been shown to have a specific interaction with the albumin protein, which is the major plasma protein in humans. This peptide can inhibit protein synthesis and may be used as a treatment for chronic renal failure, cystic fibrosis, malignant hypertension, and other conditions. The sequence of this peptide is homologous to the sequence of human kinetensin. Electron microscopic analysis showed that it has a hydrophobic side chain and an amphipathic structure.</p>

<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (16-41) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>

<p>H-Glu-Glu-Glu-OH is an amino acid sequence that has been shown to have low toxicity and a high therapeutic index. It is a carboxyl group containing oligopeptide, which can be used as a treatment agent for various conditions. H-Glu-Glu-Glu-OH has an amino group and acidic side chain at the COOH terminus, which is responsible for its protonated form. This protonated form of H-Glu-Glu-Glu-OH binds to the follicle cells in the ovaries, inhibiting them from releasing eggs. The carboxyl terminus of H-Glu-Glu-Glgol OH is deprotonated, which allows it to bind to the cell membrane surface of cancer cells and inhibit their growth by interfering with protein synthesis.</p>

<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>

<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>

<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Lys-Ala-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bis(4-methylphenyl) sulfone is an industrial chemical used in the manufacture of other chemicals. It is a sulfone that contains a hydroxyl group and a methylating agent. The reaction solution must be anhydrous and contain sodium carbonate, chloride, and methylating agent. The product can be synthesized by the Suzuki coupling reaction between an alkyl halide and an aryl boronic acid. This process requires activation energies of about 40-45 kcal/mol to drive the reaction forward. The hydrochloric acid reacts with the hydroxyl group on the sulfone to form a chlorosulfonic acid intermediate, which reacts with methylene chloride to produce bis(4-methylphenyl) sulfone. The carbonyl group on this intermediate is activated by adding methoxy groups, which are then replaced by chlorine atoms in order to form bis(4-chlorophenyl) sulfone.</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Pro2,D-Trp6·8, Nle 10)-Neurokinin B including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gly-Gly-OMe·HCl is a diagnostic agent that can be used to diagnose atherosclerotic lesions. It is conjugated to an organic molecule and then radiolabeled. The conjugate can be detected by cyclopentadienyl, which emits gamma rays when it decays. This conjugate has been shown to selectively accumulate in atherosclerotic lesions of the coronary arteries, where it accumulates with a higher concentration than in the surrounding tissue. This product also has gastroprotective effects on the stomach and liver and can reduce lipid levels in hyperlipidaemic patients.</p>

<p>Please enquire for more information about Fmoc-D-Tyr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>

<p>Suc-Ala-Ala-Pro-Ile-pNA is an enzyme that belongs to the family of zymogens. It is a tetrapeptide that is synthesized in the cytosol and transported into the lumen of the intestine, where it is cleaved by trypsin to form pepsin A. In humans, this enzyme has been localized to the duodenum and jejunum. Suc-Ala-Ala-Pro-Ile-pNA is activated by trypsin and cleaves proteins at their carboxyl side chains. It also binds to specific residues in proteins, including those with unpaired cysteine residues.</p>

<p>Ac-Tyr-OEt is a synthetic peptide with the amino acid sequence Ac-Tyr-OEt. It is a signal peptide that enhances the efficiency of protein secretion in soybean cells. It binds to hydroxyl groups on sephadex g-100, which may be due to hydrogen bonding between the two. The rate constant for this reaction has been measured at 2.5 x 10^6 M^(-1)s^(-1) and the caproic acid concentration for half-maximal binding has been determined to be 3 mM. Ac-Tyr-OEt also has protease activity, as demonstrated by its ability to hydrolyze carboxypeptidase A at a rate of 1.7 x 10^4 min^(-1).</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>

<p>Anti-Inflammatory Peptide 3 (AIP3) is a peptide that contains an ester linkages and a carboxylic ester, which are both hydrophobic. The amino acid sequence of AIP3 is H-Met-Gln-Met-Asn-Lys-Val-Leu-Asp-Ser. AIP3 has been shown to have antiinflammatory properties and can be used as a diagnostic tool for inflammation. This peptide also has prodrug properties and can be conjugated with drugs to form drug linkers.</p>

<p>Please enquire for more information about Z-Homoarg (Pbf)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MeOSuc-Ala-Ala-Pro-Val-pNA is specific chromogenic substrate for human elastase.</p>

<p>Please enquire for more information about Z-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Fluoro-2-methoxyphenylacetone is a chemical with a wide array of applications in research and industry. It is a versatile building block, useful intermediate, and reagent for organic synthesis. This compound has been used as a starting material in the synthesis of other compounds. CAS No. 1017082-10-8</p>

<p>Please enquire for more information about H-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Phe-Pro-Phe-pNA is a recombinant isomerase that has been shown to be an immunosuppressive agent. It is able to catalyze the conversion of cyclosporin A into its two inactive forms, as well as the conversion of cyclophilins A and B into their corresponding inactive forms. The enzyme has also been shown to have chaperone activity. Suc-Ala-Phe-Pro-Phe-pNA has been expressed in Escherichia coli and purified from inclusion bodies using an affinity column with immobilized recombinant cyclophilin A and B. The enzyme's activity was measured by catalysis of the conversion of pNPP, a substrate analogue, into pNPPdG, which can be detected spectrophotometrically at a wavelength of 340 nm. Suc-Ala-Phe-Pro-Phe-pNA shows exponential growth in the presence of</p>

<p>Please enquire for more information about HIV Protease Substrate III-B (Native Sequence) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Phenylalanine benzyl ester hydrochloride is an ester of L-phenylalanine and benzoic acid. It has a solubility of 1.9g/L in water, 2.1g/L in methanol, and 0.8g/L in acetonitrile at 20°C. The melting point is 119°C to 120°C and the boiling point is 243°C to 244°C at atmospheric pressure. This compound can be synthesized by reacting formamide with L-phenylalanine chloride in the presence of hexamethylphosphoramide as a catalyst.</p>

<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>

<p>Please enquire for more information about (Val4)-Angiotensin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Alpha-Phellandrene is a type of monoterpene that has been shown to have antioxidant properties. Alpha-Phellandrene is also known to inhibit the herpes simplex virus. In addition, alpha-Phellandrene has been shown to be a lipid and fatty acid oxidation inhibitor. Alpha-Phellandrene has been studied as an analgesic and anticonvulsant drug in animal models for pain relief and epilepsy treatment. Alpha-Phellandrene has also been studied for its ability to inhibit the production of prostaglandins by human liver cells. This terpene can be found in many plants, including thyme, lemon balm, peppermint, lavender and basil. The main chemical structure of alpha-Phellandrene is a bicyclic monoterpene with two isoprenyl units linked to a cyclohexane ring. It belongs to the group of monoterpenes which are derived from geranylgeranyl py</p>

<p>1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine (DLPE) is a lipid molecule that can induce phase transition in aqueous solutions. DLPE is an active ingredient in nonsteroidal anti-inflammatory drugs and has been shown to inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase. DLPE also inhibits the growth of infectious organisms such as Escherichia coli and HIV by inhibiting receptor activity. DLPE binds to receptors on the surface of cells, which prevents these cells from releasing inflammatory cytokines.</p>

<p>Methyl ester of z-alanine and aspartic acid. The methyl ester is the reaction product of z-alanine and aspartic acid, which are modified amino acids. The methyl ester is a modification of an amino acid at its carboxyl group. This active site is found in the profile of a number of enzymes, including those that catalyze the hydrolysis of amides or esters. It may also be involved in the catalytic activity of alcohols. Z-Ala-Asp-OH can act as an inhibitor to certain enzymes that break down proteins, such as peptidases and proteases. It has been shown to be resistant to hydrolysis by amide and c-terminal amidases.</p>

<p>Please enquire for more information about Glutaryl-Ala-Ala-Phe-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urotensin I including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Ala-Ala-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>

<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Prepro-Atrial Natriuretic Factor (104-123) (human) H-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu -Thr-Ala Pro Arg -OH is a natriuretic peptide hormone that belongs to the family of hormones called atrial natriuretic peptides. It is produced in the heart and has been shown to lower blood pressure by dilating blood vessels. Prepronatrial atrial natriuretic factor can also be used as a marker for colorectal adenocarcinoma, with high levels found in the serum of patients suffering from this disease.</p>

<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>

<p>Please enquire for more information about H-Ala-Ala-Ala-Tyr-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>