
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30476 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-SVNELIYK^-OH
<p>Peptide H-SVNELIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVESITDIR^-OH
<p>Peptide H-TVESITDIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGLPISQR^-OH
<p>Peptide H-VGLPISQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neuropeptide-Like Protein 12 (NLP-12) (33-39) (54-60) amide (C. elegans)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:937.05 g/molSIVmac239 - 92
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,565.9 g/molH-ILGG-NH2
<p>Peptide H-ILGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-XXXXXX-OH
<p>Peptide Biot-XXXXXX-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVLLPQK^-OH
<p>Peptide H-GVLLPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATFQTPDFIVPLTDLR^-OH
<p>Peptide H-ATFQTPDFIVPLTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NS2(114 - 121), Influenza
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C48H74N12O12Molecular weight:1,011.2 g/molH-YPDAVATWLNPDPSQK^-OH
<p>Peptide H-YPDAVATWLNPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STSGGTAALGCLVK^-OH
<p>Peptide H-STSGGTAALGCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VVVVVVD-OH
<p>Peptide Ac-VVVVVVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C56H92N14O20SMolecular weight:1,313.5 g/mol1-Adamantanecarbonyl-Arg-Phe-NH2
<p>Peptide 1-Adamantanecarbonyl-Arg-Phe-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PUMA amide peptide
<p>PUMA (p53 upregulated modulator of apoptosis) is a potent pro-apoptotic protein that plays a critical role in stress-induced cell death. It is primarily activated by the tumor suppressor p53 in response to DNA damage, but can also be triggered by other factors in response to various cellular stresses. PUMA functions by disrupting the balance of Bcl-2 family proteins, leading to mitochondrial dysfunction and caspase activation. Due to its involvement in various diseases, PUMA is considered a potential therapeutic target for both cancer and neurodegenerative diseases.</p>H-GK^GDPK^K^PR-OH
<p>Peptide H-GK^GDPK^K^PR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSVLTVTHQDWL^NGK-OH
<p>Peptide H-VVSVLTVTHQDWL^NGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>JasmonicAcid-I^-OH
<p>Peptide JasmonicAcid-I^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-AYEQNPQHFIEDLEK-OH
<p>Peptide LCBiot-AYEQNPQHFIEDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSAVLQSGFRK-NH2
<p>Peptide H-TSAVLQSGFRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLGAFSDGLAHLDNLK^-OH
<p>Peptide H-VLGAFSDGLAHLDNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KAQPAQPADEPAE-NH2
<p>Peptide Ac-KAQPAQPADEPAE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGSGSFGTVYK^-OH
<p>Peptide H-IGSGSFGTVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 118 (DEDSDNEIHNPAVFT)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,702.7 g/molH-GNPTVEVELTTEK^-OH
<p>Peptide H-GNPTVEVELTTEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIQEILTQV^-OH
<p>Peptide H-KIQEILTQV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYTDASFTNR^-OH
<p>Peptide H-EYTDASFTNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVQEVTDFAK^-OH
<p>Peptide H-LVQEVTDFAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LL^-OH
<p>Peptide H-LL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSVEALNSLTGEFK^-OH
<p>Peptide H-LSVEALNSLTGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Atrial Natriuretic Factor (1-28)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C127H203N45O39S3Molecular weight:3,080.46 g/molAc-AMVSEFLKQAWFIENEEQEYVQTVK-OH
<p>Peptide Ac-AMVSEFLKQAWFIENEEQEYVQTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGIETPLPK^-OH
<p>Peptide H-LLGIETPLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-PKPPKPVSKMRMATPLLMQA-OH
<p>Peptide Biot-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNFYAWK^-OH
<p>Peptide H-VNFYAWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-GAGSLQPLALEGSLQKRG-OH
<p>Peptide Fluor-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPTFIPAPIQAK^-OH
<p>Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Glicentin (By similarity)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C340H532N108O119S2Molecular weight:8,100.68 g/molBoc-Gln-Ala-Arg-pNA hydrochloride salt
CAS:<p>Boc-Gln-Ala-Arg-pNA hydrochloride salt is a reagent, speciality chemical, and useful building block. It is used as a reaction component in the synthesis of complex compounds. Boc-Gln-Ala-Arg-pNA hydrochloride salt can be used as a versatile building block for the construction of new scaffolds. The high purity and quality of this compound make it an excellent choice for research chemicals and other fine chemicals.</p>Formula:C25H39N9O8·xHClPurity:Min. 95%Color and Shape:PowderMolecular weight:593.63 g/molH-LTFDEYR^-OH
<p>Peptide H-LTFDEYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
<p>Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).</p>H-LNIPTDVLK^-OH
<p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Z-GLF-CMK
<p>Peptide Z-GLF-CMK is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Secretin (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C130H220N44O40Molecular weight:3,039.45 g/molBiot-KKLNRTLSFAEPG-NH2
<p>Peptide Biot-KKLNRTLSFAEPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neuropeptide Y (free acid) (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C189H284N54O58S1Molecular weight:4,272.8 g/molH-GGIVDEGALLR^-OH
<p>Peptide H-GGIVDEGALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>sgp91 ds-tat Peptide 2, scrambled
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C98H190N50O22SMolecular weight:2,453 g/molH-GLNEEIAR^V-OH
<p>Peptide H-GLNEEIAR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
