CAS 118997-30-1

Peptid YY menschlich

Beschreibung:

Peptid YY (PYY) ist ein Neuropeptid, das hauptsächlich im Magen-Darm-Trakt, insbesondere im Ileum und im Kolon, als Reaktion auf die Nahrungsaufnahme produziert wird. Es spielt eine entscheidende Rolle bei der Regulierung des Appetits und des Energiehaushalts, indem es die Magenmotilität hemmt und das Sättigungsgefühl fördert. Die menschliche Form von PYY, identifiziert durch die CAS-Nummer 118997-30-1, besteht aus 36 Aminosäuren und ist strukturell mit anderen Neuropeptiden wie Neuropeptid Y (NPY) und Pankreaspolypeptid (PP) verwandt. PYY wird postprandial freigesetzt, was bedeutet, dass seine Werte nach dem Essen ansteigen, und es wirkt auf spezifische Rezeptoren im Gehirn, um Hungersignale zu reduzieren. Darüber hinaus wurde PYY in verschiedenen physiologischen Prozessen, einschließlich der Modulation der Insulinsekretion und der gastrointestinalen Funktion, impliciert. Seine potenziellen therapeutischen Anwendungen werden im Kontext von Fettleibigkeit und Stoffwechselstörungen untersucht, da eine Verbesserung der PYY-Signalübertragung bei der Regulierung des Appetits und des Gewichtsmanagements helfen könnte. Insgesamt ist PYY ein bedeutender Akteur im komplexen Netzwerk von Hormonen, die die Energiehomöostase steuern.

Formel: C₁₉₄H₂₉₅N₅₅O₅₇

Synonyme:

• H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• Peptide YY (human)
• Peptide Yy, Human
• Peptide YY (human) Acetate
• PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• PubChem ID: 126455957
• TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
• PEPTIDE YY, HUMAN USP/EP/BP
• Peptide YY (human)|Peptide YY, PYY, human
• PYY (HUMAN)
• PEPTIDE YY PYY HUMAN
• YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
• Peptide YY human, ≥97% (HPLC)
• M.W. 4309.75 C194H295N55O57
• H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• Human peptide YY

Peptide YY (human)

CAS: 118997-30-1

Peptide YY has been isolated from human colonic extracts. It is identical in sequence to porcine PYY except for two amino acid replacements.

Formel: C₁₉₄H₂₉₅N₅₅O₅₇

Reinheit: > 95%

Farbe und Form: White Powder

Molekulargewicht: 4309.81

Ref: 01-4013882

Peptide YY (human)

CAS: 118997-30-1

Formel: C₁₉₄H₂₉₅N₅₅O₅₇

Reinheit: 97%

Molekulargewicht: 4309.7524

Ref: IN-DA008RSH

Peptide YY (PYY), human

CAS: 118997-30-1

PYY: a 36-amino-acid hormone, amidated, part of neuroendocrine control, acts via Neuropeptide Y receptors.

Formel: C₁₉₄H₂₉₅N₅₅O₅₇

Reinheit: 98%

Farbe und Form: Solid

Molekulargewicht: 4309.75

Ref: TM-TP1762

Peptide YY (human) trifluoroacetate salt

CAS: 118997-30-1

Peptide YY (PYY) is a 36-amino acid peptide that is secreted by the gut. PYY is a potent inhibitor of food intake and glucose homeostasis in rats and may be involved in the regulation of lipid metabolism. The trifluoroacetate salt form of PYY has been shown to have improved solubility, stability, and bioavailability. It has also been found to be more selective for the PYY receptor than other forms of PYY. The trifluoroacetate salt form of PYY remains stable to phase chromatography under acidic conditions but degrades at higher pH levels.

Formel: C₁₉₄H₂₉₅N₅₅O₅₇

Reinheit: Min. 95%

Molekulargewicht: 4,309.75 g/mol

Ref: 3D-FP110394