CAS 12279-41-3

Seractid

Beschreibung:

Seractid, mit der CAS-Nummer 12279-41-3, ist eine chemische Verbindung, die hauptsächlich für ihre Anwendung im Bereich der Pharmazie und Biochemie bekannt ist. Es handelt sich um ein synthetisches Tensid, das Eigenschaften wie Emulgierung, Benetzung und Dispersion aufweist, was es in verschiedenen Formulierungen nützlich macht. Seractid wird häufig bei der Herstellung von Arzneimittellieferungssystemen eingesetzt, um die Löslichkeit und Bioverfügbarkeit von schwer löslichen Verbindungen zu verbessern. Seine amphiphile Natur ermöglicht es ihm, sowohl mit hydrophilen als auch mit hydrophoben Substanzen zu interagieren, was die Stabilisierung von Emulsionen und Suspensionen erleichtert. Darüber hinaus kann Seractid biologische Aktivität besitzen, was zu seiner Rolle bei der Verbesserung der Wirksamkeit therapeutischer Mittel beiträgt. Sicherheits- und Handhabungshinweise sind wichtig, wenn man mit dieser Verbindung arbeitet, wie bei vielen Tensiden, aufgrund möglicher reizender Eigenschaften. Insgesamt dient Seractid als wertvolles Werkzeug in pharmazeutischen Formulierungen und der Forschung und trägt zu Fortschritten in der Arzneimittelliefertechnologie bei.

Formel: C₂₀₇H₃₀₈N₅₆O₅₈S₁

Synonyme:

• L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-asparaginylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine
• Acth(1-39)
• CORTICOTROPIN (HUMAN)
• ACTH (1-39), HUMAN
• Seractide USP/EP/BP
• H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH
• ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
• Seractide
• CORTICOTROPIN A
• REF DUPL: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
• ACTH (1-39) (huMan)
• Adrenocorticotropic hormone fragment 1-39, ≥97% (HPLC)
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE
• ACTH (1-39) (human) trifluoroacetate salt H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt
• Adrenocorticotropic Hormone (ACTH) (1-39)
• H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
• Seractide ACTH
• Adrenocorticotropic Hormone (ACTH) (1-39), human
• Seractide acetate
• PCorticotropin (Human) CAS 12279-41-3
• ACTH
• M.W. 4541.07 C207H308N56O58S
• CORTICOTROPHIN
• Corticotropin
• adrenocorticotropic hormone fragment 1-39
• SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN
• ADRENOCORTICOTROPIC HORMONE HUMAN

ACTH (1-39) (human)

CAS: 12279-41-3

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Formel: C₂₀₇H₃₀₈N₅₆O₅₈S

Reinheit: 99.2%

Farbe und Form: White

Molekulargewicht: 4541.13

Ref: 01-4030325

a1-39-Corticotropin (human)

CAS: 12279-41-3

Formel: C₂₀₇H₃₀₈N₅₆O₅₈S

Reinheit: 98%

Farbe und Form: Solid

Molekulargewicht: 4541.0658

Ref: IN-DA01CP9W

ACTH (1-39) human

CAS: 12279-41-3

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH (1-39), human) is an agonist of melanocortin receptor.

Formel: C₂₀₇H₃₀₈N₅₆O₅₈S

Reinheit: 99.6%

Farbe und Form: White Lyophilised Solid

Molekulargewicht: 4541.14

Ref: TM-T8231

ACTH(1-39) trifluoroacetate

CAS: 12279-41-3

ACTH(1-39) trifluoroacetate is a synthetic form of ACTH that is used for the diagnosis of autoimmune diseases and bowel disease. It is also used to assess the function of the adrenal gland in cases of suspected Cushing's syndrome. The blood sampling procedure involves withdrawing a small amount of blood from the patient and adding ACTH(1-39) trifluoroacetate to it, which causes an increase in cortisol concentration. ACTH(1-39) trifluoroacetate binds to corticotropin receptors on cells in the body, causing them to release basic proteins that are responsible for inflammation. This drug may be a potential biomarker for metabolic disorders such as obesity. It has been shown to have anti-inflammatory properties and can be used as a nonsteroidal anti-inflammatory drug (NSAID).

Formel: C₂₀₇H₃₀₈N₅₆O₅₈S

Reinheit: Min. 98 Area-%

Farbe und Form: Powder

Molekulargewicht: 4,541.07 g/mol

Ref: 3D-FA108368