CAS 133514-43-9

Exendin-Fragment 9-39

Beschreibung:

Exendin-Fragment 9-39 ist ein Peptid, das von dem Molekül Exendin-4 abgeleitet ist, das ein Analogon des Glucagon-ähnlichen Peptids-1 (GLP-1) ist. Dieses spezifische Fragment ist bekannt für seine Rolle als kompetitiver Antagonist des GLP-1-Rezeptors, der in der Regulierung des Glukosestoffwechsels und der Insulinsekretion von Bedeutung ist. Das Peptid besteht aus 31 Aminosäuren und zeichnet sich durch seine Fähigkeit aus, die Wirkungen von GLP-1 zu hemmen, was es zu einem interessanten Thema in der Diabetesforschung und potenziellen therapeutischen Anwendungen macht. Seine Struktur umfasst eine Sequenz, die es ihm ermöglicht, an den GLP-1-Rezeptor zu binden, aber im Gegensatz zu GLP-1 aktiviert es den Rezeptor nicht und blockiert somit dessen Wirkungen. Die CAS-Nummer 133514-43-9 identifiziert diese Verbindung eindeutig in chemischen Datenbanken und erleichtert deren Studium und Anwendung in pharmakologischen Kontexten. Insgesamt dient Exendin-Fragment 9-39 als wertvolles Werkzeug zum Verständnis der Signalübertragung des GLP-1-Rezeptors und seiner Implikationen bei Stoffwechselstörungen.

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Synonyme:

• Exendin (9-39)
• Exendin(9-39)amide
• Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
• H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• Exendin-3 (9-39) amide USP/EP/BP
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
• Exendin Fragment 9-39 >=95% (HPLC)
• 9-39-Exendin 3(Heloderma horridum) (9CI)
• EXENDIN-3 (9-39) AMIDE
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
• 9-39-Exendin 3(Heloderma horridum)
• DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p...
• Exendin 4 (9-39) amide
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• M.W. 3369.79 C149H234N40O47S
• Exendin FragMent 9-39Exendin
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• EXENDIN [9-39] PEPTIDE
• EXENDIN FRAGMENT 9-39
• EXENDIN FRAGMENT 9-39;EXENDIN (9-39)
• Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC)
• Exendin (9-39) Acetate

Exendin (9-39)

CAS: 133514-43-9

For cellular and molecular biology applications

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Molekulargewicht: 3369.75

Ref: 02-J66126

Exendin (9-39)

CAS: 133514-43-9

Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide and of exendin-4 on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Reinheit: 97.4%

Farbe und Form: White Powder

Molekulargewicht: 3369.8

Ref: 01-4017799

Exendin (9-39)

CAS: 133514-43-9

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Reinheit: 99%

Farbe und Form: Solid

Molekulargewicht: 3369.7571

Ref: IN-DA00ILPD

Exendin Fragment 9-39

CAS: 133514-43-9

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Reinheit: ≥ 95.0%

Farbe und Form: White powder

Molekulargewicht: 3369.75

Ref: 7W-GK0935

Avexitide

CAS: 133514-43-9

Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Reinheit: 98% - 99.65%

Farbe und Form: Solid

Molekulargewicht: 3369.76

Ref: TM-TP2100

Exendin (9-39)

CAS: 133514-43-9

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Molekulargewicht: 3,369.79 g/mol

Ref: 3D-PP50554

Exendin (9-39) acetate

CAS: 133514-43-9

Exendin (9-39) acetate is a peptide hormone that is derived from the salivary gland of the Gila monster. It binds to receptors in the pancreas and inhibits insulin release. Exendin (9-39) acetate has been shown to increase glomerular filtration rate, natriuresis, and plasma glucose levels in animals. This peptide also increases soluble guanylate cyclase activity, which leads to an increase in cellular cGMP levels and vasodilation. Exendin (9-39) acetate has been shown to inhibit the production of cyclic guanosine monophosphate (cGMP) by inhibiting adenylyl cyclase activity. It also binds to receptors on pancreatic beta cells and inhibits insulin release, as well as binding to receptors on vascular smooth muscle cells and causing vasodilation.

Formel: C₁₄₉H₂₃₄N₄₀O₄₇S

Reinheit: Min. 95%

Molekulargewicht: 3,369.76 g/mol

Ref: 3D-FE110341