
CAS 159002-68-3
:GLUCAGON-37 (MENSCH, MAUS, RATTE)
Beschreibung:
Glucagon-37 ist ein Peptidhormon, das eine entscheidende Rolle im Glukosestoffwechsel spielt und hauptsächlich von den Alpha-Zellen der Bauchspeicheldrüse produziert wird. Es handelt sich um ein 37-Aminosäure-Polypeptid, das ein Mitglied der Glucagon-Hormonfamilie ist. Diese Substanz ist daran beteiligt, die Blutzuckerspiegel zu erhöhen, indem sie die Gluconeogenese und die Glykogenolyse in der Leber fördert. Glucagon-37 ist besonders bedeutend im Kontext der metabolischen Regulation und wird auf seine potenziellen Implikationen im Diabetesmanagement untersucht. Die CAS-Nummer 159002-68-3 identifiziert dieses Peptid spezifisch, das für Forschungs- und pharmazeutische Anwendungen relevant ist. In Bezug auf seine biochemischen Eigenschaften weist Glucagon-37 einen hohen Grad an Spezifität für seinen Rezeptor, den Glucagonrezeptor, auf, der ein G-Protein-gekoppelter Rezeptor ist. Diese Interaktion löst eine Kaskade von intrazellulären Signalwegen aus, die letztendlich zur Mobilisierung von Energiespeichern führen. Das Verständnis der Struktur und Funktion von Glucagon-37 ist entscheidend für die Entwicklung therapeutischer Strategien für Stoffwechselstörungen.
- Oxm (Human, Mouse, Rat)
- Oxyntomodulin (Human, Mouse, Rat)
- Preproglucagon (53-89) (Human, Mouse, Rat)
- Proglucagon (33-69) (Human, Mouse, Rat)
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-Oh
Sortieren nach
Reinheit (%)
0
100
|
0
|
50
|
90
|
95
|
100
3 Produkte.
Oxyntomodulin (human, mouse, rat)
CAS:Oxyntomodulin potently inhibits gastric acid secretion and pancreatic enzyme secretion when infused iv. Moreover, it was shown that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner.Formel:C192H295N61O60SReinheit:95.3%Farbe und Form:White PowderMolekulargewicht:4449.9Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFormel:C192H295N61O60SReinheit:Min. 95%Molekulargewicht:4,449.93 g/molOxyntomodulin (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormel:C192H295N61O60SReinheit:Min. 95%Molekulargewicht:4,449.84 g/mol

