CAS 9015-71-8

Corticotropin-Releasing-Faktor

Beschreibung:

Corticotropin-Releasing-Faktor (CRF), auch bekannt als Corticotropin-Releasing-Hormon (CRH), ist ein Peptidhormon, das an der Stressreaktion beteiligt ist. Es wird im Hypothalamus produziert und spielt eine entscheidende Rolle in der Hypothalamus-Hypophysen-Nebennieren-Achse (HPA), indem es die Freisetzung von adrenocorticotropem Hormon (ACTH) aus der Hypophyse stimuliert. CRF besteht aus 41 Aminosäuren und zeigt eine Reihe biologischer Aktivitäten, einschließlich der Modulation der Immunantwort und des Einflusses auf Verhalten und Stimmung. Die Substanz zeichnet sich durch ihre Fähigkeit aus, an spezifische Rezeptoren zu binden, nämlich die CRF-Rezeptoren 1 und 2, die im gesamten Gehirn und in peripheren Geweben verteilt sind. CRF ist auch an verschiedenen physiologischen Prozessen beteiligt, einschließlich der Regulierung der zirkadianen Rhythmen und der Reaktion auf Stressoren. Seine Dysregulation ist mit mehreren psychiatrischen und physiologischen Störungen verbunden, was es zu einem Ziel für die Forschung zu stressbedingten Erkrankungen macht. Die CAS-Nummer 9015-71-8 identifiziert dieses Peptid eindeutig in chemischen Datenbanken und erleichtert dessen Studium und Anwendung in der biomedizinischen Forschung.

Formel: C₂₀₅H₃₃₉N₅₉O₆₃S₁

Synonyme:

• ACTH - releasing factor
• ACTH-releasing hormone
• CRF
• CRF (hormone)
• CRH
• Corticoliberin
• Corticotrophin-releasing hormone
• Corticotropin-Releasing Hormone
• Corticotropin-releasing activity
• Corticotropin-releasing hormone-41
• Crf (Ovine)
• Crf-41
• Corticotropin-releasing factor
• Corticotropin-releasing factor
• CORTICOTROPIN RELEASING FACTOR SHEEP
• corticotropin-releasinghormone))-
• H-SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2
• SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 OVINE
• Corticotropin releasing factor 41
• SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
• SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2
• Corticorelin Ovine (x = 4.1-8.2)
• Corticotropin Releasing Factor sheep, ≥95% (HPLC)
• CRF, CRH
• Corticotropin Releasing Factor, CRF, ovine
• CORTICOTROPIN RELEASING FACTOR, OVINE

CRF (Ovine)

CAS: 9015-71-8

Corticotropin Releasing Factor (CRF) is a peptide hormone involved in the regulation of the neuroendocrine system, the hypothalamic-pituitary-adrenal (HPA) axis. The hypothalamus releases CRF during stress and in turn CRF stimulates the production of stress hormones such as glucocorticoids and adrenocorticotropin (ACTH). A negative feedback loop is created as glucocorticoids then prevents further endocrine activity exhibited by the pituitary gland and hypothalamus. Interestingly in patients with depression, it has been found that the hypothalamic-pituitary adrenal axis is over stimulated thus increased production of CRF occurs resulting in depression symptoms. Furthermore studies have shown the expression of CRF receptors in glial cells and T-cells and elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments. 
This product is available as a 0.1mg vial.

Formel: C₂₀₅H₃₃₉N₅₉O₆₃S

Reinheit: Min. 95%

Molekulargewicht: 4,670.3 g/mol

Ref: 3D-PCR-4111-S

CRF (Ovine)

CAS: 9015-71-8

This product is an ovine, Corticotropin Release Factor (CRF) and is available as a 0.5mg vial. CRF is a peptide hormone and a key regulator of the hypothalamic-pituitary adrenal (HPA) axis. In response to stress the hypothalams releases CRF which stimulates the production of glucocorticoids and adrenocorticotropin, which are stress hormones. Glucocorticoids are then involved in a negative feedback loop, in that they prevent the pituitary gland and hypothalamus from exhibiting any further endocrine activity. Studies have shown that symptoms of depression can be caused by the over production of CRF due to the overstimulation of the hypothalamic-pituitary adrenal axis. Interestingly CRF receptors are expressed in both glial cells and T cells. Elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments.

Formel: C₂₀₅H₃₃₉N₅₉O₆₃S

Reinheit: Min. 95%

Molekulargewicht: 4,670.3 g/mol

Ref: 3D-PCR-4111-V