CAS 90880-35-6

Neuropeptid Y menschlich

Beschreibung:

Neuropeptid Y (NPY) ist ein 36-Aminosäure-Peptid, das eine entscheidende Rolle in verschiedenen physiologischen Prozessen spielt, einschließlich der Regulierung des Appetits, der zirkadianen Rhythmen und der Stressreaktion. Es wird hauptsächlich im zentralen Nervensystem produziert und ist an der Neurotransmission beteiligt. Die menschliche Form des Neuropeptids Y, identifiziert durch die CAS-Nummer 90880-35-6, weist einen hohen Grad an Erhaltung über die Arten hinweg auf, was auf ihre grundlegende biologische Bedeutung hinweist. NPY funktioniert, indem es an spezifische Rezeptoren bindet, hauptsächlich an die Y1- und Y2-Rezeptoren, die G-Protein-gekoppelte Rezeptoren sind. Diese Bindung kann eine Reihe von zellulären Reaktionen beeinflussen, einschließlich der Modulation der Neurotransmitterfreisetzung und der Regulierung des Energiehaushalts. Darüber hinaus ist NPY an verschiedenen pathologischen Bedingungen beteiligt, wie Fettleibigkeit, Angst und Depression, was es zu einem Ziel für therapeutische Forschung macht. Seine Stabilität und Bioaktivität werden von Faktoren wie posttranslationalen Modifikationen und der Anwesenheit spezifischer Rezeptor-Subtypen beeinflusst, was seine Komplexität als Signalmolekül im Nervensystem hervorhebt.

Formel: C₁₈₉H₂₈₄N₅₅O₅₇RS

Synonyme:

• Neuropeptide Y (human), 36-L-tyrosine-
• NeuropeptideY (pig), 17-L-methionine-36-L-tyrosine-
• Neuropeptide Y, Human
• NEUROPEPTIDE Y (HUMAN, RAT) USP/EP/BP
• hnpy
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• REF DUPL: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• Neuropeptide Y (29-64), amide, human
• Neuropeptide Y (huMan, rat)
• hNPY, NPY
• Neuropeptide Y (Alligator mississippiensis)
• Neuropeptide Y (human, rat) Acetate
• NEUROPEPTIDE Y (HUMAN, RAT)
• Human neuropeptide Y (29-64)
• YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• M.W. 4271.68 C189H285N55O57S
• Neuropeptide Y (rat)
• NPY (HUMAN, RAT)
• H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-OH
• NPY FREE ACID (HUMAN, RAT)
• Neuropeptide Y (Gopherus agassizii)
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• NEUROPEPTIDE Y FREE ACID (HUMAN, RAT)
• Neuropeptide Y (human pheochromocytoma)
• NPY (huMan, rat)
• TYP-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR
• Neuropeptide Y(1-36)

Neuropeptide Y, Human

CAS: 90880-35-6

For cellular and molecular biology applications

Formel: C₁₈₉H₂₈₅N₅₅O₅₇S

Molekulargewicht: 4271.74

Ref: 02-J66797

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Bachem ID: 4012616.

Formel: C₁₈₉H₂₈₅N₅₅O₅₇S

Reinheit: 95.2%

Farbe und Form: White

Molekulargewicht: 4271.74

Ref: 01-4012616

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Formel: C₆₅H₁₄₂N₂₆O₃

Reinheit: 98%

Molekulargewicht: 1335.9954

Ref: IN-DA00GRZM

Neuropeptide Y (human)

CAS: 90880-35-6

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

Formel: C₁₈₉H₂₈₅N₅₅O₅₇S

Reinheit: 98%

Farbe und Form: Solid

Molekulargewicht: 4271.68

Ref: TM-TP1140

Neuropeptide Y

CAS: 90880-35-6

Neuropeptide Y

Ref: 54-BIBA1035

NPY (Human, Rat)

CAS: 90880-35-6

NPY is a potent inhibitor of the ion channel TRPM2. This protein has been shown to be involved in a variety of physiological functions, including regulation of body weight and food intake, sleep-wake cycles, and pain perception. It is also an important regulator of neuronal excitability. NPY (Human) can be used as a research tool for studying protein interactions or investigating the function of ion channels in cellular systems. NPY (Rat) can be used as an antibody for immunohistochemistry or Western blotting experiments.

Formel: C₁₈₉H₂₈₅N₅₅O₅₇S

Reinheit: Min. 95%

Molekulargewicht: 4,271.7 g/mol

Ref: 3D-PNP-4158-S

Neuropeptide Y, human

CAS: 90880-35-6

Neuropeptide Y is a potent neuropeptide that regulates many biological processes in vertebrates. It has been shown to regulate various processes, including feeding, anxiety, reproduction, and pain. Neuropeptide Y is synthesized as an amide of the amino acid L-tyrosine. The synthetic peptide can be either enantiomer or a mixture of both enantiomers. The presence of neuropeptides Y in the extracellular fluid is potently regulated by the neuropeptide Y receptor subtype 2 (Y2R). Neuropeptide Y has been shown to inhibit egg development in mosquitoes when injected into their ovaries at high doses. This effect was dose-dependent and was mediated by receptors on the surface of cho-k1 cells (a rat kidney cell line). The homologues of neuropeptide Y are called peptides PYY and PYY3-36.

Formel: C₁₈₉H₂₈₅N₅₅O₅₇S

Reinheit: Min. 95%

Molekulargewicht: 4,271.69 g/mol

Ref: 3D-FN73521

NPY (Human, Rat)

CAS: 90880-35-6

NPY (Human, Rat) is a peptide that belongs to the family of neuropeptides. It is a central neurotransmitter and neuromodulator in the brain and has an important role in the regulation of many physiological processes, including feeding behavior, body weight, blood pressure, stress responses and reproduction. NPY (Human, Rat) is used as a research tool for studying ion channels and receptor interactions. This product is also used to develop antibodies that can be used as a research tool or diagnostic reagent. NPY (Human, Rat) is not active when taken orally; it must be injected into the body.

Formel: C₁₈₉H₂₈₅N₅₅O₅₇S

Reinheit: Min. 95%

Molekulargewicht: 4,271.7 g/mol

Ref: 3D-PNP-4158-V

Neuropeptide Y (human, rat) trifluoroacetate salt

CAS: 90880-35-6

Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Formel: C₁₈₉H₂₈₅N₅₅O₅₇S

Reinheit: Min. 95%

Molekulargewicht: 4,271.69 g/mol

Ref: 3D-FN109816